KEGG   Homo sapiens (human): 9389Help
Entry
9389              CDS       T01001                                 

Gene name
SLC22A14, OCTL2, OCTL4, ORCTL4
Definition
(RefSeq) solute carrier family 22 member 14
  KO
K08210  MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 14
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    9389 (SLC22A14)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   9389 (SLC22A14)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    9389 (SLC22A14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1 TMEM238 DUF4131
Motif
Other DBs
NCBI-GeneID: 9389
NCBI-ProteinID: NP_001306962
OMIM: 604048
HGNC: 8495
Ensembl: ENSG00000144671
Vega: OTTHUMG00000131082
Pharos: Q9Y267(Tdark)
UniProt: Q9Y267
Position
3p22.2
AA seq 594 aa AA seqDB search
MAGEENFKEELRSQDASRNLNQHEVAGHPHSWSLEMLLRRLRAVHTKQDDKFANLLDAVG
EFGTFQQRLVALTFIPSIMSAFFMFADHFVFTAQKPYCNTSWILAVGPHLSKAEQLNLTI
PQAPNGSFLTCFMYLPVPWNLDSIIQFGLNDTDTCQDGWIYPDAKKRSLINEFDLVCGME
TKKDTAQIMFMAGLPIGSLIFRLITDKMGRYPAILLSLLGLIIFGFGTAFMNSFHLYLFF
RFGISQSVVGYAISSISLATEWLVGEHRAHAIILGHCFFAVGAVLLTGIAYSLPHWQLLF
LVGGILVIPFISYIWILPESPRWLMMKGKVKEAKQVLCYAASVNKKTIPSNLLDELQLPR
KKVTRASVLDFCKNRQLCKVTLVMSCVWFTVSYTYFTLSLRMRELGVSVHFRHVVPSIME
VPARLCCIFLLQQIGRKWSLAVTLLQAIIWCLLLLFLPEGEDGLRLKWPRCPATELKSMT
ILVLMLREFSLAATVTVFFLYTAELLPTVLRATGLGLVSLASVAGAILSLTIISQTPSLL
PIFLCCVLAIVAFSLSSLLPETRDQPLSESLNHSSQIRNKVKDMKTKETSSDDV
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcaggagaggagaacttcaaggaagagctcagatcccaggatgcttccaggaacttg
aaccagcatgaggtagcaggacatccacattcctggtctctggagatgctgttacgcaga
ttgagggctgtccacaccaagcaggatgacaagtttgccaacctcctggatgcggtgggg
gagtttggcacattccagcagaggctagtagccctcacctttatccccagcatcatgtcg
gccttcttcatgtttgctgaccacttcgtgttcacagcccagaagccctattgcaatacc
agctggatcctggcagtgggcccccacctgtccaaagctgagcagctgaatctgaccata
ccccaagcacccaatggcagtttcctgacatgcttcatgtaccttcctgtgccttggaat
ctggattctatcatccagtttggcctcaatgacacagacacatgccaagatgggtggatc
tatcctgacgctaagaagcgatcgctgatcaatgagtttgacttggtatgtggcatggag
acgaagaaggacactgcacagatcatgttcatggcagggctcccgataggctctctcatc
ttcaggctcataactgacaagatgggccgctaccctgccatcctgctgtcactgctgggg
ctgatcatcttcggctttgggacagccttcatgaacagctttcacctgtatttgttcttt
cgctttggcatctcgcagtcagtggtgggctacgccatcagcagcatttctttggccact
gagtggttagtgggtgagcaccgggcccatgccattatcctgggacactgctttttcgct
gttggggccgtgttgctgacagggatcgcctacagtcttccccactggcagctgctgttt
ctggtgggtgggatacttgtgatccccttcatctcctatatctggattctcccggagtcc
ccgcggtggctgatgatgaaagggaaggtgaaggaggccaagcaggtgctgtgctacgcc
gcaagtgtgaacaagaagaccattccttcaaatctgctggacgagctgcagctgcccaga
aagaaggtgactcgggcctctgtcctggacttctgtaagaataggcagctctgcaaggtg
accttggtgatgagctgtgtgtggtttaccgtcagttacacctattttacgttgagcctg
agaatgagagagctgggcgtgagcgtccacttcagacacgtggtccccagcatcatggag
gtgcctgcccggctgtgctgcatctttctcctccagcagattgggaggaagtggagcctg
gctgtgactctcctccaagccatcatctggtgcttgcttctccttttcctccctgaaggg
gaggatggcctcagactcaagtggccacgttgtccggccacagagctgaaatccatgacg
atcttggtgctcatgctcagagagttcagcctggccgccactgtcactgtgttcttcctc
tacaccgctgagctcctccccactgtgctcagggcgacaggtctggggctggtgtctctg
gcctcggtggctggagccatcttgtccctgacaatcatcagccagaccccctccctcctg
cccatctttctctgctgcgtcttagccatcgtggccttttccctctcctccctgctgccg
gaaacgcgagatcagcccctctccgagagcctgaaccactcctcacagataaggaataag
gtcaaggacatgaagactaaggaaacatcatctgatgatgtctga

DBGET integrated database retrieval system