KEGG   Homo sapiens (human): 939Help
Entry
939               CDS       T01001                                 

Gene name
CD27, S152, S152._LPFS2, T14, TNFRSF7, Tp55
Definition
(RefSeq) CD27 molecule
  KO
K05144  tumor necrosis factor receptor superfamily member 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    939 (CD27)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   939 (CD27)
CD molecules [BR:hsa04090]
 Proteins
  939 (CD27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6
Motif
Other DBs
NCBI-GeneID: 939
NCBI-ProteinID: NP_001233
OMIM: 186711
HGNC: 11922
Ensembl: ENSG00000139193
Vega: OTTHUMG00000168316
Pharos: P26842(Tbio)
UniProt: P26842
Structure
PDB: 

Position
12p13.31
AA seq 260 aa AA seqDB search
MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCCQMCEPGTFLVKDCDQHRKAA
QCDPCIPGVSFSPDHHTRPHCESCRHCNSGLLVRNCTITANAECACRNGWQCRDKECTEC
DPLPNPSLTARSSQALSPHPQPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPP
QRSLCSSDFIRILVIFSGMFLVFTLAGALFLHQRRKYRSNKGESPVEPAEPCRYSCPREE
EGSTIPIQEDYRKPEPACSP
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcacggccacatccctggtggctgtgcgttctggggaccctggtggggctctcagct
actccagcccccaagagctgcccagagaggcactactgggctcagggaaagctgtgctgc
cagatgtgtgagccaggaacattcctcgtgaaggactgtgaccagcatagaaaggctgct
cagtgtgatccttgcataccgggggtctccttctctcctgaccaccacacccggccccac
tgtgagagctgtcggcactgtaactctggtcttctcgttcgcaactgcaccatcactgcc
aatgctgagtgtgcctgtcgcaatggctggcagtgcagggacaaggagtgcaccgagtgt
gatcctcttccaaacccttcgctgaccgctcggtcgtctcaggccctgagcccacaccct
cagcccacccacttaccttatgtcagtgagatgctggaggccaggacagctgggcacatg
cagactctggctgacttcaggcagctgcctgcccggactctctctacccactggccaccc
caaagatccctgtgcagctccgattttattcgcatccttgtgatcttctctggaatgttc
cttgttttcaccctggccggggccctgttcctccatcaacgaaggaaatatagatcaaac
aaaggagaaagtcctgtggagcctgcagagccttgtcgttacagctgccccagggaggag
gagggcagcaccatccccatccaggaggattaccgaaaaccggagcctgcctgctccccc
tga

DBGET integrated database retrieval system