KEGG   Homo sapiens (human): 9390
Entry
9390              CDS       T01001                                 
Symbol
SLC22A13, OAT10, OCTL1, OCTL3, ORCTL-3, ORCTL3
Name
(RefSeq) solute carrier family 22 member 13
  KO
K08209  MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 13
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    9390 (SLC22A13)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   9390 (SLC22A13)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    9390 (SLC22A13)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 9390
NCBI-ProteinID: NP_004247
OMIM: 604047
HGNC: 8494
Ensembl: ENSG00000172940
Pharos: Q9Y226(Tbio)
UniProt: Q9Y226
Position
3:38265812..38278757
AA seq 551 aa
MAQFVQVLAEIGDFGRFQIQLLILLCVLNFLSPFYFFAHVFMVLDEPHHCAVAWVKNHTF
NLSAAEQLVLSVPLDTAGHPEPCLMFRPPPANASLQDILSHRFNETQPCDMGWEYPENRL
PSLKNEFNLVCDRKHLKDTTQSVFMAGLLVGTLMFGPLCDRIGRKATILAQLLLFTLIGL
ATAFVPSFELYMALRFAVATAVAGLSFSNVTLLTEWVGPSWRTQAVVLAQCNFSLGQMVL
AGLAYGFRNWRLLQITGTAPGLLLFFYFWALPESARWLLTRGRMDEAIQLIQKAASVNRR
KLSPELMNQLVPEKTGPSGNALDLFRHPQLRKVTLIIFCVWFVDSLGYYGLSLQVGDFGL
DVYLTQLIFGAVEVPARCSSIFMMQRFGRKWSQLGTLVLGGLMCIIIIFIPADLPVVVTM
LAVVGKMATAAAFTISYVYSAELFPTILRQTGMGLVGIFSRIGGILTPLVILLGEYHAAL
PMLIYGSLPIVAGLLCTLLPETHGQGLKDTLQDLELGPHPRSPKSVPSEKETEAKGRTSS
PGVAFVSSTYF
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggctcagtttgtccaggtcctggctgaaataggtgactttggtcgcttccagatacag
ctattgatcctgctgtgtgttctcaacttcctgtctcccttctacttttttgcccatgtc
ttcatggtcctagatgagccccaccactgtgcagtggcttgggtgaagaaccacactttc
aacctgagtgctgctgaacagctggtactgagcgtgcccctggacactgcaggtcaccca
gagccctgcctcatgttccggccaccccccgccaatgccagcctgcaggacatcctcagc
caccgcttcaatgagacgcagccttgtgatatgggctgggaatatcctgagaacaggctc
ccatccctgaagaatgagttcaacctggtttgtgatcggaagcacctgaaggacaccaca
cagtcagtgttcatggctgggctccttgttggcaccctcatgtttgggcccctctgcgac
cggattggccgcaaggccacaatcctggcgcagctgctcctcttcaccctcatcggcctg
gccacagcttttgtgcccagctttgagctctacatggccctgcgctttgctgtggctact
gccgtcgctggacttagcttcagcaatgtcaccctactgacagaatgggtggggccctca
tggaggacgcaggccgtggtcctggcccagtgcaacttctccctcgggcagatggtgctt
gcgggactcgcctacggtttccgcaactggaggctccttcagatcaccggcactgcgcct
ggcttactgctcttcttctacttctgggctctgccagaatctgcacgttggctcctgacc
cgtgggaggatggacgaggcgatacaactgatccagaaggcggcctcggtcaataggcgg
aaactctccccggagctcatgaaccagctggtcccagagaagacaggcccctcagggaat
gccctggatctgttcagacacccccagctccggaaggtgaccctgattatcttctgtgtc
tggtttgtggacagtctggggtactacggcctgagcctccaagtgggggacttcggcctg
gacgtctatctgacgcagctcatctttggagctgttgaggtgcctgcccgctgttccagc
atcttcatgatgcagaggtttggccgcaagtggagccagttggggaccttggtcttgggt
ggcctgatgtgtatcatcatcatcttcatcccagcagatctgcccgtggtggtcaccatg
ctggctgtggtggggaagatggccacagctgctgcctttaccatctcctatgtgtactct
gccgagcttttccccaccatcctccggcagacaggcatggggctggtgggcatcttctca
cggatcgggggcatcctcacaccacttgtgatcctgctgggagagtaccacgctgccctc
cccatgctcatctacggcagcctccccatcgtggccggcctgctgtgcaccctgctgcca
gagacgcatggccagggcctgaaagacaccctccaggacctggagctggggcctcaccca
cggtcccccaaatcagtgccctcagagaaggaaacagaggccaagggaagaacttccagc
ccgggagtggcctttgtgagcagcacatacttctga

DBGET integrated database retrieval system