KEGG   Homo sapiens (human): 9397
Entry
9397              CDS       T01001                                 
Symbol
NMT2
Name
(RefSeq) N-myristoyltransferase 2
  KO
K00671  glycylpeptide N-tetradecanoyltransferase [EC:2.3.1.97]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    9397 (NMT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.97  glycylpeptide N-tetradecanoyltransferase
     9397 (NMT2)
SSDB
Motif
Pfam: NMT_C NMT Acetyltransf_1 Acetyltransf_9
Other DBs
NCBI-GeneID: 9397
NCBI-ProteinID: NP_004799
OMIM: 603801
HGNC: 7858
Ensembl: ENSG00000152465
UniProt: O60551
Position
10:complement(15105700..15168693)
AA seq 498 aa
MAEDSESAASQQSLELDDQDTCGIDGDNEEETEHAKGSPGGYLGAKKKKKKQKRKKEKPN
SGGTKSDSASDSQEIKIQQPSKNPSVPMQKLQDIQRAMELLSACQGPARNIDEAAKHRYQ
FWDTQPVPKLDEVITSHGAIEPDKDNVRQEPYSLPQGFMWDTLDLSDAEVLKELYTLLNE
NYVEDDDNMFRFDYSPEFLLWALRPPGWLLQWHCGVRVSSNKKLVGFISAIPANIRIYDS
VKKMVEINFLCVHKKLRSKRVAPVLIREITRRVNLEGIFQAVYTAGVVLPKPIATCRYWH
RSLNPRKLVEVKFSHLSRNMTLQRTMKLYRLPDVTKTSGLRPMEPKDIKSVRELINTYLK
QFHLAPVMDEEEVAHWFLPREHIIDTFVVESPNGKLTDFLSFYTLPSTVMHHPAHKSLKA
AYSFYNIHTETPLLDLMSDALILAKSKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYL
YNWRCPGTDSEKVGLVLQ
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggcggaggacagcgagtctgcggccagccagcagagcctggaactggacgaccaggac
acgtgcgggatagacggggacaatgaggaggagacggagcacgccaaaggaagtcctgga
gggtatttgggagccaaaaagaaaaagaagaaacagaagagaaaaaaggagaaaccaaat
tccggaggcaccaagtcagactcggcatctgattcccaggagattaaaattcagcagcct
tcgaaaaatcccagtgttccaatgcagaagttgcaggatatccagagagcaatggagctg
ctatccgcatgccagggcccagccaggaacattgatgaggctgcaaagcacagataccag
ttttgggacacacaaccggtaccaaaactagatgaagtcataacatctcatggtgcaatt
gaaccagataaagacaacgtacgccaagaaccgtattctttgccacagggttttatgtgg
gacactttagacttgagtgatgccgaagtgctcaaggagttatacacgttgttaaatgag
aattacgtagaagatgatgacaatatgttccgatttgactattcacccgagttcctgttg
tgggctctgcgtccaccaggctggctcctgcagtggcactgtggggtcagagtgtcttca
aataaaaaactggtcgggttcataagtgccatcccagcaaacattcggatttatgacagt
gtgaagaagatggtagaaatcaactttctttgtgttcataagaagttgagatcgaaacgg
gtagccccagtgctaatccgagagatcactagaagagtgaacctggaagggatcttccag
gctgtgtacaccgcgggagtggttcttcctaagcccatagccacatgcagatactggcat
cgatcactaaaccccagaaaattggtagaagtgaaattttctcacttgagtagaaatatg
actttacagagaacaatgaagctatacagacttccagatgttacaaagacttcaggtttg
agaccaatggaaccaaaagatatcaaatcagttcgagaattaatcaacacttacctgaag
cagtttcatctggctccagtgatggatgaagaggaagtagcccactggttcctcccccgg
gagcacattattgacacgtttgtagtggagagccccaacggtaaactgactgatttcctg
agcttctatacgctcccctccacggtgatgcaccaccctgctcacaagagcctcaaagcc
gcctactcattctacaacatccacacagagacgcccctgctggacctcatgagcgacgcg
ctcatcctggctaaatcgaaaggatttgatgtattcaatgcactggatttgatggaaaat
aagacattcttggaaaaactcaagtttggtataggagatggcaatttgcagtattacctg
tacaattggaggtgtccaggtacagattctgaaaaggttggactagtactacaatag

DBGET integrated database retrieval system