KEGG   Homo sapiens (human): 93973Help
Entry
93973             CDS       T01001                                 

Gene name
ACTR8, ARP8, INO80N, hArp8
Definition
(RefSeq) actin related protein 8
  KO
K11673  actin-related protein 8
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    93973 (ACTR8)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Chromatin remodeling factors
   INO80 complex
    93973 (ACTR8)
   INO80 complex (yeast)
    93973 (ACTR8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin Actin_micro
Motif
Other DBs
NCBI-GeneID: 93973
NCBI-ProteinID: NP_075050
HGNC: 14672
Ensembl: ENSG00000113812
Vega: OTTHUMG00000158279
Pharos: Q9H981(Tdark)
UniProt: Q9H981
Structure
PDB: 

Position
3p21.1
AA seq 624 aa AA seqDB search
MTQAEKGDTENGKEKGGEKEKEQRGVKRPIVPALVPESLQEQIQSNFIIVIHPGSTTLRI
GRATDTLPASIPHVIARRHKQQGQPLYKDSWLLREGLNKPESNEQRQNGLKMVDQAIWSK
KMSNGTRRIPVSPEQARSYNKQMRPAILDHCSGNKWTNTSHHPEYLVGEEALYVNPLDCY
NIHWPIRRGQLNIHPGPGGSLTAVLADIEVIWSHAIQKYLEIPLKDLKYYRCILLIPDIY
NKQHVKELVNMILMKMGFSGIVVHQESVCATYGSGLSSTCIVDVGDQKTSVCCVEDGVSH
RNTRLCLAYGGSDVSRCFYWLMQRAGFPYRECQLTNKMDCLLLQHLKETFCHLDQDISGL
QDHEFQIRHPDSPALLYQFRLGDEKLQAPMALFYPATFGIVGQKMTTLQHRSQGDPEDPH
DEHYLLATQSKQEQSAKATADRKSASKPIGFEGDLRGQSSDLPERLHSQEVDLGSAQGDG
LMAGNDSEEALTALMSRKTAISLFEGKALGLDKAILHSIDCCSSDDTKKKMYSSILVVGG
GLMFHKAQEFLQHRILNKMPPSFRRIIENVDVITRPKDMDPRLIAWKGGAVLACLDTTQE
LWIYQREWQRFGVRMLRERAAFVW
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggctgagaagggtgatacggagaacggaaaggagaagggcggcgagaaggag
aaggagcagcgcggcgtgaagcggcccatcgtgcccgcgctggtgccggagtcgctgcaa
gagcaaatccagagcaacttcatcattgtcatacatccaggttcaacaactttaaggatt
ggtcgagccacagacactcttcctgccagcattcctcacgtcattgcccgaagacacaaa
caacaagggcagcccctatacaaggacagttggctcctaagggagggactaaataaacca
gaaagtaatgaacaaagacaaaatggccttaaaatggtggatcaagcaatatggtctaaa
aagatgtccaatggtacaagacgcattcctgtgtcccctgaacaggcacgctcctacaat
aagcagatgcgacctgcaattttagatcactgttcgggaaataagtggacaaacacatct
catcaccctgagtatttagtaggagaagaggccttgtatgttaatccactggactgttac
aatattcactggcctatcagaagaggtcagttaaatattcacccaggccctgggggctct
cttacagctgttctggcagatattgaagtaatatggtctcatgcgatacaaaaatacttg
gaaatcccactgaaagatttaaagtattatagatgtatcttgttaattcctgatatctat
aataagcagcatgtgaaagaactagtgaatatgatactaatgaagatgggtttttcaggg
attgtggtccatcaggagtctgtgtgtgccacctatggaagtggcttaagcagcacgtgt
attgtagacgttggggaccagaagacaagtgtatgctgtgtggaggatggggtgtctcat
cggaatactcggctttgtctggcatacggaggatctgatgtgtcaagatgtttttactgg
ctaatgcagcgagctgggttcccttacagagaatgccagttaacaaataaaatggattgt
cttcttctgcaacaccttaaagaaactttttgtcatttagatcaggacatctctgggctt
caggaccatgagtttcagattcgacatcctgattctcctgccctgctttaccagtttcga
ttaggagatgaaaaactgcaggctccaatggctttgttttaccccgcaacttttggaatc
gttggacagaaaatgacgactttgcagcacagatctcagggcgatcctgaggatcctcac
gatgaacattacctgctggccacacagagcaaacaagaacagtctgcaaaagctactgct
gaccgaaagtctgcatccaaacctattggatttgaaggggatcttcgtggccagtcctct
gatcttccagaaagactccattcccaggaggtagatttggggtctgcacagggagatggc
ctgatggccggcaacgattccgaggaggccctcactgcactgatgtccaggaagactgcc
atctcgctgtttgaaggaaaagccctgggcctggataaagccatcctccatagcatagac
tgctgttcatctgacgacaccaaaaagaagatgtacagctccatcctagtggtgggaggt
ggtttgatgtttcataaagctcaagaatttctgcagcacagaattctcaacaaaatgcca
ccatccttcaggcgaattattgaaaatgtggatgtgatcacaaggcctaaggacatggac
ccccggctgattgcatggaaaggaggggcagtgttggcttgtttggatacaacacaggaa
ctgtggatttatcagcgagagtggcagcgctttggtgtccgcatgttacgagagcgggct
gcgtttgtgtggtga

DBGET integrated database retrieval system