KEGG   Homo sapiens (human): 93986Help
Entry
93986             CDS       T01001                                 

Gene name
FOXP2, CAGH44, SPCH1, TNRC10
Definition
(RefSeq) forkhead box P2
  KO
K09409  forkhead box protein P
Organism
hsa  Homo sapiens (human)
Disease
H00902  Speech-language disorder 1
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    93986 (FOXP2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix other regulators
    93986 (FOXP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FOXP-CC Forkhead CobT Plasmodium_Vir RR_TM4-6
Motif
Other DBs
NCBI-GeneID: 93986
NCBI-ProteinID: NP_055306
OMIM: 605317
HGNC: 13875
Ensembl: ENSG00000128573
Vega: OTTHUMG00000023131
Pharos: O15409(Tbio)
UniProt: O15409
Structure
PDB: 

Position
7q31.1
AA seq 715 aa AA seqDB search
MMQESATETISNSSMNQNGMSTLSSQLDAGSRDGRSSGDTSSEVSTVELLHLQQQQALQA
ARQLLLQQQTSGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQA
LLQQQQAVMLQQQQLQEFYKKQQEQLHLQLLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
QQQQQQQQQQQHPGKQAKEQQQQQQQQQQLAAQQLVFQQQLLQMQQLQQQQHLLSLQRQG
LISIPPGQAALPVQSLPQAGLSPAEIQQLWKEVTGVHSMEDNGIKHGGLDLTTNNSSSTT
SSNTSKASPPITHHSIVNGQSSVLSARRDSSSHEETGASHTLYGHGVCKWPGCESICEDF
GQFLKHLNNEHALDDRSTAQCRVQMQVVQQLEIQLSKERERLQAMMTHLHMRPSEPKPSP
KPLNLVSSVTMSKNMLETSPQSLPQTPTTPTAPVTPITQGPSVITPASVPNVGAIRRRHS
DKYNIPMSSEIAPNYEFYKNADVRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAY
FRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEYQKRRSQKITGSPTLVKNIPT
SLGYGAALNASLQAALAESSLPLLSNPGLINNASSGLLQAVHEDLNGSLDHIDSNGNSSP
GCSPQPHIHSIHVKEEPVIAEDEDCPMSLVTTANHSPELEDDREIEEEPLSEDLE
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaggaatctgcgacagagacaataagcaacagttcaatgaatcaaaatggaatg
agcactctaagcagccaattagatgctggcagcagagatggaagatcaagtggtgacacc
agctctgaagtaagcacagtagaactgctgcatctgcaacaacagcaggctctccaggca
gcaagacaacttcttttacagcagcaaacaagtggattgaaatctcctaagagcagtgat
aaacagagaccactgcaggtgcctgtgtcagtggccatgatgactccccaggtgatcacc
cctcagcaaatgcagcagatccttcagcaacaagtcctgtctcctcagcagctacaagcc
cttctccaacaacagcaggctgtcatgctgcagcagcaacaactacaagagttttacaag
aaacagcaagagcagttacatcttcagcttttgcagcagcagcagcaacagcagcagcag
caacaacagcagcaacaacagcagcagcaacaacaacaacaacagcagcaacaacagcag
cagcagcagcaacagcagcagcagcagcaacagcatcctggaaagcaagcgaaagagcag
cagcagcagcagcagcagcaacagcaattggcagcccagcagcttgtcttccagcagcag
cttctccagatgcaacaactccagcagcagcagcatctgctcagccttcagcgtcaggga
ctcatctccattccacctggccaggcagcacttcctgtccaatcgctgcctcaagctggc
ttaagtcctgctgagattcagcagttatggaaagaagtgactggagttcacagtatggaa
gacaatggcattaaacatggagggctagacctcactactaacaattcctcctcgactacc
tcctccaacacttccaaagcatcaccaccaataactcatcattccatagtgaatggacag
tcttcagttctaagtgcaagacgagacagctcgtcacatgaggagactggggcctctcac
actctctatggccatggagtttgcaaatggccaggctgtgaaagcatttgtgaagatttt
ggacagtttttaaagcaccttaacaatgaacacgcattggatgaccgaagcactgctcag
tgtcgagtgcaaatgcaggtggtgcaacagttagaaatacagctttctaaagaacgcgaa
cgtcttcaagcaatgatgacccacttgcacatgcgaccctcagagcccaaaccatctccc
aaacctctaaatctggtgtctagtgtcaccatgtcgaagaatatgttggagacatcccca
cagagcttacctcaaacccctaccacaccaacggccccagtcaccccgattacccaggga
ccctcagtaatcaccccagccagtgtgcccaatgtgggagccatacgaaggcgacattca
gacaaatacaacattcccatgtcatcagaaattgccccaaactatgaattttataaaaat
gcagatgtcagacctccatttacttatgcaactctcataaggcaggctatcatggagtca
tctgacaggcagttaacacttaatgaaatttacagctggtttacacggacatttgcttac
ttcaggcgtaatgcagcaacttggaagaatgcagtacgtcataatcttagcctgcacaag
tgttttgttcgagtagaaaatgttaaaggagcagtatggactgtggatgaagtagaatac
cagaagcgaaggtcacaaaagataacaggaagtccaaccttagtaaaaaatatacctacc
agtttaggctatggagcagctcttaatgccagtttgcaggctgccttggcagagagcagt
ttacctttgctaagtaatcctggactgataaataatgcatccagtggcctactgcaggcc
gtccacgaagacctcaatggttctctggatcacattgacagcaatggaaacagtagtccg
ggctgctcacctcagccgcacatacattcaatccacgtcaaggaagagccagtgattgca
gaggatgaagactgcccaatgtccttagtgacaacagctaatcacagtccagaattagaa
gacgacagagagattgaagaagagcctttatctgaagatctggaatga

DBGET integrated database retrieval system