KEGG   Homo sapiens (human): 9402
Entry
9402              CDS       T01001                                 

Gene name
GRAP2, GADS, GRAP-2, GRB2L, GRBLG, GRID, GRPL, GrbX, Grf40, Mona, P38
Definition
(RefSeq) GRB2 related adaptor protein 2
  KO
K07366  GRB2-related adaptor protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04660  T cell receptor signaling pathway
Network
nt06120  Calcium signaling (viruses and bacteria)
  Element
N01106  TCR-NFAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    9402 (GRAP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    9402 (GRAP2)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   9402 (GRAP2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH2 SH3_2 DUF5348 SH2_2 SH3_3 NADH_dhqG_C DUF2076
Other DBs
NCBI-GeneID: 9402
NCBI-ProteinID: NP_001278753
OMIM: 604518
HGNC: 4563
Ensembl: ENSG00000100351
Vega: OTTHUMG00000151097
Pharos: O75791(Tbio)
UniProt: O75791 Q6FI14
Structure
PDB: 
5GJH

Position
22q13.1
AA seq 330 aa
MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFH
EGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTE
KFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRP
SMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDIN
DGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEV
LDSSNPSWWTGRLHNKLGLFPANYVAPMTR
NT seq 993 nt   +upstreamnt  +downstreamnt
atggaagctgttgccaagtttgatttcactgcttcaggtgaggatgaactgagctttcac
actggagatgttttgaagattttaagtaaccaagaggagtggtttaaggcggagcttggg
agccaggaaggatatgtgcccaagaatttcatagacatccagtttcccaaatggtttcac
gaaggcctctctcgacaccaggcagagaacttactcatgggcaaggaggttggcttcttc
atcatccgggccagccagagctccccaggggacttctccatctctgtcaggcatgaggat
gacgttcaacacttcaaggtcatgcgagacaacaagggtaattactttctgtggactgag
aagtttccatccctaaataagctggtagactactacaggacaaattccatctccagacag
aagcagatcttccttagagacagaacccgagaagaccagggtcaccggggcaacagcctg
gaccggaggtcccagggaggcccacacctcagtggggctgtgggagaagaaatccgacct
tcgatgaaccggaagctgtcggatcaccccccgacccttcccctgcagcagcaccagcac
cagccacagcctccgcaatatgccccagcgccccagcagctgcagcagcccccacagcag
cgatatctgcagcaccaccatttccaccaggaacgccgaggaggcagccttgacataaat
gatgggcattgtggcaccggcttgggcagtgaaatgaatgcggccctcatgcatcggaga
cacacagacccagtgcagctccaggcggcagggcgagtgcggtgggcccgggcgctgtat
gactttgaggccctggaggatgacgagctggggttccacagcggggaggtggtggaggtc
ctggatagctccaacccatcctggtggaccggccgcctgcacaacaagctgggcctcttc
cctgccaactacgtggcacccatgacccgataa

DBGET integrated database retrieval system