KEGG   Homo sapiens (human): 9406Help
Entry
9406              CDS       T01001                                 

Gene name
ZRANB2, ZIS, ZIS1, ZIS2, ZNF265
Definition
(RefSeq) zinc finger RANBP2-type containing 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RanBP DUF35_N
Motif
Other DBs
NCBI-GeneID: 9406
NCBI-ProteinID: NP_976225
OMIM: 604347
HGNC: 13058
Ensembl: ENSG00000132485
Vega: OTTHUMG00000009660
Pharos: O95218(Tbio)
UniProt: O95218
Structure
PDB: 

Position
1p31.1
AA seq 330 aa AA seqDB search
MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKS
RGLFSANDWQCKTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGFNERENVEYIEREES
DGEYDEFGRKKKKYRGKAVGPASILKEVEDKESEGEEEDEDEDLSKYKLDEDEDEDDADL
SKYNLDASEEEDSNKKKSNRRSRSKSRSSHSRSSSRSSSPSSSRSRSRSRSRSSSSSQSR
SRSSSRERSRSRGSKSRSSSRSHRGSSSPRKRSYSSSSSSPERNRKRSRSRSSSSGDRKK
RRTRSRSPERRHRSSSGSSHSGSRSSSKKK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccaagaatttccgagtcagtgacggggactggatttgccctgacaaaaaatgt
ggaaatgtaaactttgctagaagaaccagctgtaatcgatgtggtcgggagaaaacaact
gaggccaagatgatgaaagctgggggcactgaaataggaaagacacttgcagaaaagagc
cgaggcctatttagtgctaatgactggcaatgtaaaacttgcagcaatgtgaattgggcc
agaagatcagagtgtaatatgtgtaatactccaaagtatgctaaattagaagaaagaaca
ggatatggtggtggttttaatgaaagagaaaatgttgaatatatagaaagagaagaatct
gatggtgaatatgatgagtttggacgtaaaaagaaaaaatacagagggaaagcagttggt
cctgcatctatattaaaggaagttgaagataaagaatcagagggagaagaagaggatgag
gatgaagatctttctaaatataagttagatgaggatgaggatgaagatgacgctgatctc
tcaaaatataatcttgatgccagtgaagaagaagatagtaataaaaagaaatctaataga
cgaagtcgctcaaagtctcgatcttcacattcacgatcttcatcacgctcatcctccccc
tcaagttcaaggtctaggtccaggtcccgttcaagaagttcttccagttcgcagtcaaga
tctcgttccagttccagagaacgttcgagatctcgtgggtcgaaatcaagatccagctcc
aggtcccacaggggctcttcttccccacgaaaaagatcttattcaagttcatcatcttct
cctgagaggaacagaaagagaagtcgttctagatcttcttcatctggtgatcgcaaaaaa
agacgaacaagatcacggtcacccgaaagacgccacaggtcatcatctggatcatcccat
tctggttcccgttcaagttcaaaaaagaaataa

DBGET integrated database retrieval system