KEGG   Homo sapiens (human): 9410Help
Entry
9410              CDS       T01001                                 

Gene name
SNRNP40, 40K, HPRP8BP, PRP8BP, PRPF8BP, SPF38, WDR57
Definition
(RefSeq) small nuclear ribonucleoprotein U5 subunit 40
  KO
K12857  Prp8 binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Module
hsa_M00354  Spliceosome, U4/U6.U5 tri-snRNP
hsa_M00355  Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    9410 (SNRNP40)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    9410 (SNRNP40)
 Complex C
   U5 SnRNP specific factors
    9410 (SNRNP40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Cytochrom_D1
Motif
Other DBs
NCBI-GeneID: 9410
NCBI-ProteinID: NP_004805
OMIM: 607797
HGNC: 30857
Ensembl: ENSG00000060688
Vega: OTTHUMG00000003790
Pharos: Q96DI7(Tbio)
UniProt: Q96DI7 A0MNP2
Structure
PDB: 

Position
1p35.2
AA seq 357 aa AA seqDB search
MIEQQKRKGPELPLVPVKRQRHELLLGAGSGPGAGQQQATPGALLQAGPPRCSSLQAPIM
LLSGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTD
GSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWD
IRKKAAIQTFQNTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTG
LSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKI
AAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgatagaacagcagaagcgtaagggcccagagttgccgctggttccagtcaagcggcag
cggcatgagttgctgttgggagcggggtctggcccaggagccgggcagcagcaggcgacg
ccgggagccttgctgcaagcgggacctccaagatgttcctcccttcaagccccaatcatg
ctgctctctggacatgaaggggaagtctactgctgcaagttccaccccaacggatccacc
ttagcatctgcaggatttgaccgactgatattactgtggaatgtctatggtgactgtgat
aactatgccacactgaagggacacagtggagcagtgatggaattgcattacaacacagat
ggcagtatgcttttctcagcatccacagataaaaccgtggctgtgtgggatagtgaaaca
ggtgagagggttaaaaggctaaagggacatacttcctttgtgaattcctgttatccagcc
aggagaggccctcagcttgtctgcactggcagtgacgatggcacagttaagctttgggac
atccggaagaaagcagccatccagacatttcagaacacgtaccaggtgttagctgtgacc
ttcaatgacacaagtgatcagattatttctggtggaatagacaatgatatcaaggtctgg
gacctgcgccagaacaagctaacctacaccatgagaggccatgcagattcagtgactggc
ctgagtttaagttctgaaggctcttatcttttgtccaatgcaatggacaatacagttcgt
gtctgggatgtccggccatttgcccccaaagagagatgtgtaaagatatttcaaggaaat
gtgcacaactttgaaaagaaccttctgagatgttcttggtcacctgatggaagcaaaata
gcagctggctcagccgacaggtttgtttatgtgtgggataccacaagcaggagaatattg
tataagctgcccggccatgctggctccatcaatgaagtggctttccaccctgatgagccc
atcattatctcagcatcgagtgacaagagactgtatatgggagagattcagtga

DBGET integrated database retrieval system