KEGG   Homo sapiens (human): 94101
Entry
94101             CDS       T01001                                 
Symbol
ORMDL1
Name
(RefSeq) ORMDL sphingolipid biosynthesis regulator 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: ORMDL
Other DBs
NCBI-GeneID: 94101
NCBI-ProteinID: NP_001121622
OMIM: 610073
HGNC: 16036
Ensembl: ENSG00000128699
Pharos: Q9P0S3(Tdark)
UniProt: Q9P0S3
Position
2:complement(189763859..189784339)
AA seq 153 aa
MNVGVAHSEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFFSVPVAWTLTNIIHNLGM
YVFLHAVKGTPFETPDQGKARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYD
PTHFILNTASLLSVLIPKMPQLHGVRIFGINKY
NT seq 462 nt   +upstreamnt  +downstreamnt
atgaacgttggagttgcccacagtgaagtgaatccaaatacccgtgtcatgaacagccgg
ggtatgtggctgacatatgcattgggagttggcttgcttcatattgtcttactcagcatt
cccttcttcagtgttcctgttgcttggactttaacaaatattatacataatctggggatg
tacgtatttttgcatgcagtgaaaggaacacctttcgaaactcctgaccagggtaaagca
aggctcctaactcattgggaacaactggactatggagtacagtttacatcttcacggaag
tttttcacaatttctccaataattctatattttctggcaagtttctatacgaagtatgat
ccaactcacttcatcctaaacacagcttctctcctgagtgtactaattcccaaaatgcca
caactacatggtgttcggatctttggaattaataagtattga

DBGET integrated database retrieval system