KEGG   Homo sapiens (human): 94101Help
Entry
94101             CDS       T01001                                 

Gene name
ORMDL1
Definition
(RefSeq) ORMDL sphingolipid biosynthesis regulator 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: ORMDL
Motif
Other DBs
NCBI-GeneID: 94101
NCBI-ProteinID: NP_001121622
OMIM: 610073
HGNC: 16036
Ensembl: ENSG00000128699
Vega: OTTHUMG00000132661
Pharos: Q9P0S3(Tdark)
UniProt: Q9P0S3
Position
2q32.2
AA seq 153 aa AA seqDB search
MNVGVAHSEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFFSVPVAWTLTNIIHNLGM
YVFLHAVKGTPFETPDQGKARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYD
PTHFILNTASLLSVLIPKMPQLHGVRIFGINKY
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttggagttgcccacagtgaagtgaatccaaatacccgtgtcatgaacagccgg
ggtatgtggctgacatatgcattgggagttggcttgcttcatattgtcttactcagcatt
cccttcttcagtgttcctgttgcttggactttaacaaatattatacataatctggggatg
tacgtatttttgcatgcagtgaaaggaacacctttcgaaactcctgaccagggtaaagca
aggctcctaactcattgggaacaactggactatggagtacagtttacatcttcacggaag
tttttcacaatttctccaataattctatattttctggcaagtttctatacgaagtatgat
ccaactcacttcatcctaaacacagcttctctcctgagtgtactaattcccaaaatgcca
caactacatggtgttcggatctttggaattaataagtattga

DBGET integrated database retrieval system