KEGG   Homo sapiens (human): 94103Help
Entry
94103             CDS       T01001                                 

Gene name
ORMDL3
Definition
(RefSeq) ORMDL sphingolipid biosynthesis regulator 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: ORMDL DUF3433
Motif
Other DBs
NCBI-GeneID: 94103
NCBI-ProteinID: NP_001307730
OMIM: 610075
HGNC: 16038
Ensembl: ENSG00000172057
Vega: OTTHUMG00000133249
Pharos: Q8N138(Tbio)
UniProt: Q8N138 A0A024R1W6
Position
17q21.1
AA seq 153 aa AA seqDB search
MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGM
YIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYD
QIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgggcacagcgcacagcgaggtgaaccccaacacgcgggtgatgaacagccgt
ggcatctggctctcctacgtgctggccatcggtctcctccacatcgtgctgctgagcatc
ccgtttgtgagtgtccctgtcgtctggaccctcaccaacctcattcacaacatgggcatg
tatatcttcctgcacacggtgaaggggacaccctttgagaccccggaccagggcaaggcg
aggctgctaacccactgggagcagatggattatggggtccagttcacggcctctcggaag
ttcttgaccatcacacccatcgtgctgtacttcctcaccagcttctacactaagtacgac
cagatccattttgtgctcaacaccgtgtccctgatgagcgtgcttatccccaagctgccc
cagctccacggagtccggatttttggaatcaataagtactga

DBGET integrated database retrieval system