KEGG   Homo sapiens (human): 9411Help
Entry
9411              CDS       T01001                                 

Gene name
ARHGAP29, PARG1
Definition
(RefSeq) Rho GTPase activating protein 29
  KO
K20644  Rho GTPase-activating protein 29/45
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9411 (ARHGAP29)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    9411 (ARHGAP29)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP C1_1 LZ3wCH
Motif
Other DBs
NCBI-GeneID: 9411
NCBI-ProteinID: NP_001315593
OMIM: 610496
HGNC: 30207
Ensembl: ENSG00000137962
Vega: OTTHUMG00000010643
Pharos: Q52LW3(Tbio)
UniProt: Q52LW3
Position
1p22.1
AA seq 1261 aa AA seqDB search
MIAHKQKKTKKKRAWASGQLSTDITTSEMGLKSLSSNSIFDPDYIKELVNDIRKFSHMLL
YLKEAIFSDCFKEVIHIRLEELLRVLKSIMNKHQNLNSVDLQNAAEMLTAKVKAVNFTEV
NEENKNDLFQEVFSSIETLAFTFGNILTNFLMGDVGNDSLLRLPVSRETKSFENVSVESV
DSSSEKGNFSPLELDNVLLKNTDSIELALSYAKTWSKYTKNIVSWVEKKLNLELESTRNM
VKLAEATRTNIGIQEFMPLQSLFTNALLNDIESSHLLQQTIAALQANKFVQPLLGRKNEM
EKQRKEIKELWKQEQNKMLEAENALKKAKLLCMQRQDEYEKAKSSMFRAEEEHLSSSGGL
AKNLNKQLEKKRRLEEEALQKVEEANELYKVCVTNVEERRNDLENTKREILAQLRTLVFQ
CDLTLKAVTVNLFHMQHLQAASLADSLQSLCDSAKLYDPGQEYSEFVKATNSTEEEKVDG
NVNKHLNSSQPSGFGPANSLEDVVRLPDSSNKIEEDRCSNSADITGPSFIRSWTFGMFSD
SESTGGSSESRSLDSESISPGDFHRKLPRTPSSGTMSSADDLDEREPPSPSETGPNSLGT
FKKTLMSKAALTHKFRKLRSPTKCRDCEGIVVFQGVECEECLLVCHRKCLENLVIICGHQ
KLPGKIHLFGAEFTQVAKKEPDGIPFILKICASEIENRALCLQGIYRVCGNKIKTEKLCQ
ALENGMHLVDISEFSSHDICDVLKLYLRQLPEPFILFRLYKEFIDLAKEIQHVNEEQETK
KNSLEDKKWPNMCIEINRILLKSKDLLRQLPASNFNSLHFLIVHLKRVVDHAEENKMNSK
NLGVIFGPSLIRPRPTTAPITISSLAEYSNQARLVEFLITYSQKIFDGSLQPQDVMCSIG
VVDQGCFPKPLLSPEERDIERSMKSLFFSSKEDIHTSESESKIFERATSFEESERKQNAL
GKCDACLSDKAQLLLDQEAESASQKIEDGKTPKPLSLKSDRSTNNVERHTPRTKIRPVSL
PVDRLLLASPPNERNGRNMGNVNLDKFCKNPAFEGVNRKDAATTVCSKFNGFDQQTLQKI
QDKQYEQNSLTAKTTMIMPSALQEKGVTTSLQISGDHSINATQPSKPYAEPVRSVREASE
RRSSDSYPLAPVRAPRTLQPQHWTTFYKPHAPIISIRGNEEKPASPSAAVPPGTDHDPHG
LVVKSMPDPDKASACPGQATGQPKEDSEELGLPDVNPMCQRPRLKRMQQFEDLEGEIPQF
V
NT seq 3786 nt NT seq  +upstreamnt  +downstreamnt
atgattgctcacaaacagaaaaagacaaagaaaaaacgtgcttgggcatcaggtcaactc
tctactgatattacaacttctgaaatggggctcaagtccttaagttccaactctattttt
gatccggattacatcaaggagttggtgaatgatatcaggaagttctcccacatgttacta
tatttgaaagaagccatattttcagactgttttaaagaagttattcatatacgtctagag
gaactgctccgtgttttaaagtctataatgaataaacatcagaacctcaattctgttgat
cttcaaaatgctgcagaaatgctcactgcaaaagtgaaagctgtgaacttcacagaagtt
aatgaagaaaacaaaaacgatctcttccaggaagtgttttcttctattgaaactttggca
tttacctttggaaatatccttacaaacttccttatgggagatgtaggcaatgattcatta
ttgcgactgcctgtttctcgagaaactaagtcgtttgaaaatgtttctgtggaatcagtg
gactcatccagtgaaaaaggaaatttttcccctttagaactagacaacgtgctgttaaag
aacactgactctatcgagctggctttgtcatatgctaaaacttggtcaaaatatactaag
aacatagtttcatgggttgaaaaaaagcttaacttggaattggagtccactagaaatatg
gtcaagttggcagaggcaactagaactaacattggaattcaggagttcatgccactgcag
tctctgtttactaatgctcttcttaatgatatagaaagcagtcaccttttacaacaaaca
attgcagctctccaggctaacaaatttgtgcagcctctacttggaaggaaaaatgaaatg
gaaaaacaaaggaaagaaataaaagagctttggaaacaggagcaaaataaaatgcttgaa
gcagagaatgctctcaaaaaggcaaaattattatgcatgcaacgtcaagatgaatatgag
aaagcaaagtcttccatgtttcgtgcagaagaggagcatctgtcttcaagtggcggatta
gcaaaaaatctcaacaagcaactagaaaaaaagcgaaggttggaagaggaggctctccaa
aaagtagaagaagcaaatgaactttacaaagtttgtgtgacaaatgttgaagaaagaaga
aatgatctagaaaataccaaaagagaaattttagcacaactccggacacttgttttccag
tgtgatcttacccttaaagctgtaacagttaacctcttccacatgcagcatctgcaggct
gcttcccttgcagacagtttacagtctctctgtgatagtgccaaactctatgacccaggc
caagagtacagtgaatttgtcaaggccacaaattcaactgaagaagaaaaagttgatgga
aatgtaaataaacatttaaatagttcccaaccttcaggatttggacctgccaactcttta
gaggatgttgtacgccttcctgacagttctaataaaattgaagaggacagatgctctaac
agtgcagatataacaggtccttcctttataagatcatggacatttgggatgtttagtgat
tctgagagcactggagggagcagcgaatctagatctctggattcagaatctataagtcca
ggagactttcatcgaaaacttccacgaacaccatccagtggaactatgtcctctgcagat
gatctagatgaaagagagccaccttccccttcagaaactggacccaattcccttggaaca
tttaagaaaacattgatgtcaaaggcagctctcacacacaagtttcgcaaattgagatcc
cccacgaaatgtagggattgtgaaggcattgtagtgttccaaggtgttgaatgtgaagag
tgtctccttgtttgtcatcgaaagtgtttggaaaatttagtcattatttgtggtcatcag
aaacttccaggaaaaatacacttatttggagcagaattcacacaagttgcaaaaaaggaa
ccagatggtatcccttttatactcaaaatatgtgcctcagagattgaaaatagagctttg
tgtctacagggaatttatcgtgtgtgtggaaacaaaataaaaactgaaaaattgtgtcaa
gctttggaaaatggaatgcacttggtagatatttcagaatttagttcacatgatatctgt
gacgtcttgaaattataccttcggcagctcccagaaccatttattttatttcgattgtac
aaggaatttatagaccttgcaaaagagatccaacatgtaaatgaagaacaagagacaaaa
aagaatagtcttgaagacaaaaaatggccaaatatgtgtatagaaataaaccgaattctt
ctaaaaagcaaagaccttctaagacaattgccagcatcaaattttaacagtcttcatttc
cttatagtacatctaaagcgggtagtagatcatgcagaagaaaacaagatgaactccaaa
aacttgggggtgatatttggaccaagtctcattaggccaaggcccacaactgctcctatc
accatctcctcccttgcagagtattcaaatcaagcacgcttggtagagtttctcattact
tactcacagaagatcttcgatgggtccctacaaccacaagatgttatgtgtagcataggt
gttgttgatcaaggctgttttccaaagcctctgttatcaccagaagaaagagacattgaa
cgttccatgaagtcactatttttttcttcaaaggaagatatccatacttcagagagtgaa
agcaaaatttttgaacgagctacatcatttgaggaatcagaacgcaagcaaaatgcgtta
ggaaaatgtgatgcatgtctcagtgacaaagcacagttgcttctagaccaagaggctgaa
tcagcatcccaaaagatagaagatggtaaaacccctaagccactttctctgaaatctgat
aggtcaacaaacaatgtggagaggcatactccaaggaccaagattagacctgtaagtttg
cctgtagatagactacttcttgcaagtcctcctaatgagagaaatggcagaaatatggga
aatgtaaatttagacaagttttgcaagaatcctgcctttgaaggagttaatagaaaagac
gctgctactactgtttgttccaaatttaatggctttgaccagcaaactctacagaaaatt
caggacaaacagtatgaacaaaacagcctaactgccaagactacaatgatcatgcccagt
gcactccaggaaaaaggagtgacaacaagcctccagattagtggggaccattctatcaat
gccactcaacccagtaagccatatgcagagccagtcaggtcagtgagagaggcatctgag
agacggtcttcagattcctaccctctcgctcctgtcagagcacccagaacactgcagcct
caacattggacaacattttataaaccacatgctcccatcatcagtatcagggggaatgag
gagaagccagcttcaccctcagcagcagtgcctcctggcacagatcacgatccccacggt
ctcgtggtgaagtcaatgccagacccagacaaagcatcagcttgtcctgggcaagcaact
ggtcaacctaaagaagactctgaggagcttggcttgcctgatgtgaatccaatgtgtcag
agaccaaggctaaaacgaatgcaacagtttgaagacctcgaaggtgaaattccacaattt
gtgtag

DBGET integrated database retrieval system