KEGG   Homo sapiens (human): 94115
Entry
94115             CDS       T01001                                 
Symbol
CGB8
Name
(RefSeq) chorionic gonadotropin subunit beta 8
  KO
K10045  chorionic gonadotropin, beta polypeptide
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    94115 (CGB8)
SSDB
Motif
Pfam: Cys_knot
Other DBs
NCBI-GeneID: 94115
NCBI-ProteinID: NP_149439
OMIM: 608827
HGNC: 16453
Ensembl: ENSG00000213030
UniProt: P0DN86 A0A0F7RQP8
Structure
Position
19:complement(49047638..49049111)
AA seq 165 aa
MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPT
MTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDC
GGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
NT seq 498 nt   +upstreamnt  +downstreamnt
atggagatgttccaggggctgctgctgttgctgctgctgagcatgggcgggacatgggca
tccaaggagccgcttcggccacggtgccgccccatcaatgccaccctggctgtggagaag
gagggctgccccgtgtgcatcaccgtcaacaccaccatctgtgccggctactgccccacc
atgacccgcgtgctgcagggggtcctgccggccctgcctcaggtggtgtgcaactaccgc
gatgtgcgcttcgagtccatccggctccctggctgcccgcgcggcgtgaaccccgtggtc
tcctacgccgtggctctcagctgtcaatgtgcactctgccgccgcagcaccactgactgc
gggggtcccaaggaccaccccttgacctgtgatgacccccgcttccaggactcctcttcc
tcaaaggcccctccccccagccttccaagtccatcccgactcccggggccctcggacacc
ccgatcctcccacaataa

DBGET integrated database retrieval system