KEGG   Homo sapiens (human): 94121Help
Entry
94121             CDS       T01001                                 

Gene name
SYTL4, SLP4
Definition
(RefSeq) synaptotagmin like 4
  KO
K17598  synaptotagmin-like protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    94121 (SYTL4)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    94121 (SYTL4)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     94121 (SYTL4)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Synaptotagmins
    94121 (SYTL4)
  Small GTPases and associated proteins
   Rab associated proteins
    94121 (SYTL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2 FYVE_2 AreA_N Prok-RING_4 zf-C3HC4_3 zf-Sec23_Sec24
Motif
Other DBs
NCBI-GeneID: 94121
NCBI-ProteinID: NP_001123368
OMIM: 300723
HGNC: 15588
Ensembl: ENSG00000102362
Vega: OTTHUMG00000022004
Pharos: Q96C24(Tbio)
UniProt: Q96C24 A0A024RCF8 Q71SF7 A8K973
Structure
PDB: 

Position
Xq22.1
AA seq 671 aa AA seqDB search
MSELLDLSFLSEEEKDLILSVLQRDEEVRKADEKRIRRLKNELLEIKRKGAKRGSQHYSD
RTCARCQESLGRLSPKTNTCRGCNHLVCRDCRIQESNGTWRCKVCAKEIELKKATGDWFY
DQKVNRFAYRTGSEIIRMSLRHKPAVSKRETVGQSLLHQTQMGDIWPGRKIIQERQKEPS
VLFEVPKLKSGKSALEAESESLDSFTADSDSTSRRDSLDKSGLFPEWKKMSAPKSQVEKE
TQPGGQNVVFVDEGEMIFKKNTRKILRPSEYTKSVIDLRPEDVVHESGSLGDRSKSVPGL
NVDMEEEEEEEDIDHLVKLHRQKLARSSMQSGSSMSTIGSMMSIYSEAGDFGNIFVTGRI
AFSLKYEQQTQSLVVHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTI
NPLYDETLRYEIPESLLAQRTLQFSVWHHGRFGRNTFLGEAEIQMDSWKLDKKLDHCLPL
HGKISAESPTGLPSHKGELVVSLKYIPASKTPVGGDRKKSKGGEGGELQVWIKEAKNLTA
AKAGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHMCLELT
VWDREPLASNDFLGGVRLGVGTGISNGEVVDWMDSTGEEVSLWQKMRQYPGSWAEGTLQL
RSSMAKQKLGL
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagttactggacctttcttttctgtctgaggaggaaaaggatttgattctcagt
gttctacagcgagatgaagaggtccggaaagcagatgagaaaaggattaggcgactaaag
aatgagttactggagataaaaaggaaaggggccaagaggggcagccaacactacagtgat
cggacctgtgcccggtgccaggagagcctgggccgtttgagtcccaaaaccaatacttgt
cggggttgtaatcacctggtgtgtcgggactgccgcatacaggaaagcaatggtacctgg
aggtgcaaggtgtgcgccaaggaaatagagttgaagaaagcaactggggactggttttat
gaccagaaagtgaatcgctttgcttaccgcacaggtagtgagataatcaggatgtccctg
cgccacaaacctgcagtgagtaaaagagagacagtgggacagtccctccttcatcagaca
cagatgggtgacatctggccaggaagaaagatcattcaggagcggcagaaggagcccagt
gtgctatttgaagtgccaaagctgaaaagtggaaagagtgcattggaagctgagagtgag
agtctggatagcttcacagctgactcggatagcacctccaggagagactctctggataaa
tctggcctctttccagaatggaagaagatgtctgctcccaaatctcaagtagaaaaggaa
actcagcctggaggtcaaaatgtggtatttgtggatgagggtgagatgatatttaagaag
aacaccagaaaaatcctcaggccttcagagtacactaaatctgtgatagatcttcgccca
gaagatgtggtacatgaaagtggctccttgggagacagaagcaaatccgtcccaggcctc
aatgtggatatggaagaggaagaagaagaagaagacattgaccacctagtgaagttacat
cgccagaagctagccagaagcagcatgcaaagtggctcctccatgagtacgatcggcagc
atgatgagcatctacagtgaagctggtgatttcgggaacatctttgtgactggcaggatt
gccttttccctgaagtatgagcagcaaacccagagtctggttgtccatgtgaaggagtgc
catcagctggcctatgctgatgaagccaagaagcgctctaacccatatgtgaagacttac
cttctgcctgacaagtcccgccaaggaaaaagaaaaaccagcatcaagcgggacactatt
aatccactatatgatgagacgctgaggtatgagatcccagaatctctcctggcccagagg
accctgcagttctcagtttggcatcatggtcgttttggcagaaacactttccttggagag
gcagagatccagatggattcctggaagcttgataagaaactggatcattgcctcccttta
catggaaagatcagtgctgagtccccgactggcttgccatcacacaaaggcgagttggtg
gtttcattgaaatacatcccagcctccaaaacccctgttggaggtgaccggaaaaagagt
aaaggtggggaagggggagagctccaggtgtggatcaaagaagccaagaacttgacggct
gccaaagcaggagggacttcagacagctttgtcaagggatacctccttcccatgaggaac
aaggccagtaaacgtaaaactcctgtgatgaagaagaccctgaatcctcactacaaccat
acatttgtctacaatggtgtgaggctggaagatctacagcatatgtgcctggaactgact
gtgtgggaccgggagcccctggccagcaatgacttcctgggaggggtcaggctgggtgtt
ggcactgggatcagtaatggggaagtggtggactggatggactcgactggggaagaagtg
agcctgtggcagaagatgcgacagtacccagggtcttgggcagaagggactctgcagctc
cgttcctcaatggccaagcagaagctgggtttatga

DBGET integrated database retrieval system