KEGG   Homo sapiens (human): 94122Help
Entry
94122             CDS       T01001                                 

Gene name
SYTL5, slp5
Definition
(RefSeq) synaptotagmin like 5
  KO
K17598  synaptotagmin-like protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    94122 (SYTL5)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    94122 (SYTL5)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     94122 (SYTL5)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Synaptotagmins
    94122 (SYTL5)
  Small GTPases and associated proteins
   Rab associated proteins
    94122 (SYTL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2 FYVE_2
Motif
Other DBs
NCBI-GeneID: 94122
NCBI-ProteinID: NP_001156807
HGNC: 15589
Ensembl: ENSG00000147041
Vega: OTTHUMG00000033176
Pharos: Q8TDW5(Tdark)
UniProt: Q8TDW5
Position
Xp11.4
AA seq 730 aa AA seqDB search
MSKNSEFINLSFLLDHEKEMILGVLKRDEYLKKVEDKRIRKLKNELLEAKRRSGKTQQEA
SRVCVHCHRNLGLIFDRGDPCQACSLRVCRECRVAGPNGSWKCTVCDKIAQLRIITGEWF
FEEKAKRFKQVNVLGTDVVRQSILRRSPGAEEVQSQEQTRQDAEKSDTSPVAGKKASHDG
PKRKGFLLSKFRSATRGEIITPKTDTGRSYSLDLDGQHFRSLKSPPGSDRGSTGSSDLND
QEPGPRTPKSSRSNGVTPGTQSSPAPSTRTVTSVISREYGFENSMDLAAIEGTSQELTKS
HRRNTSGTPSIAVSGTSLSSDQSRSELDLSESFTEDSEDTVSIRSKSVPGALDKDSLEET
EESIDALVSSQLSTNTHRLASGLSTTSLNSMMSVYSETGDYGNVKVSGEILLHISYCYKT
GGLYIFVKNCRNLAIGDEKKQRTDAYVKSYLLPDKSRNNKRKTKIRTGTNPEFNETLKYT
ISHTQLETRTLQLSVWHYDRFGRNSFLGEVEIPFDSWNFENPTDEWFVLQPKVEFAPDIG
LQYKGELTVVLRYIPPEENLMLPPEQLQGNKTFKKGKKKESPVISGGILEVFIKEAKNLT
AVKSGGTSDSFVKGYLLPDDSKATKHKTLVIKKSVNPQWNHTFMFSGIHPQDIKNVCLEL
TIWDKEAFSSNIFLGGVRLNSGSGVSHGKNVDWMDSQGEEQRLWQKMANNPGTPFEGVLM
LRSSMGKCRL
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagaactcagagttcatcaatctgtcatttttattagatcatgagaaggaaatg
atcctgggcgtcctaaagagagatgaatatttgaaaaaagtggaggacaagagaataagg
aagctgaaaaatgaactcttagaagcaaaacgtagaagtgggaaaactcaacaagaggcc
agcagagtttgtgttcactgtcacagaaacctgggcctaatctttgaccggggagaccct
tgtcaggcttgctcactgagggtatgcagggagtgtcgagttgcaggccccaatggcagc
tggaagtgcactgtctgtgacaaaatcgcgcagctaaggattataactggtgagtggttt
tttgaagaaaaggcaaaacgtttcaagcaagtcaatgttctcggcactgatgttgtccga
cagtccattttaagaagaagtccaggagctgaagaagtacagagccaagagcaaacccgc
caggatgcagaaaagtcagacacttcacctgttgctgggaagaaggccagccatgatggg
cccaagagaaagggatttcttcttagcaagttcagatcggcaaccagaggagaaatcata
actcccaaaactgacactgggcggagctatagcttggacttagacggtcaacattttcgg
agtttaaaatcacctcctggttcagacaggggaagcactggctcatcagatctcaatgac
caggaacctggtcctaggaccccgaagagcagtcggagcaatggtgtgaccccaggcact
cagagttcaccagccccaagcacacgaactgtgacctcagtcatcagtagagagtatggt
tttgaaaattccatggatttggctgctattgaaggtacctctcaggagctcacaaagagt
caccgcagaaacacttctggcacaccttccatagcagtgtctggaacctctctctcctca
gatcagagtcgatctgagttagatttgagtgagtcatttacagaagactcagaggatact
gtaagcataagaagcaagtctgtccctggggctttagacaaggactccttggaagagact
gaagaaagcattgatgccttagtgtcctcgcagttatctacaaacactcaccgtctggca
agtggcctatcaactaccagccttaacagcatgatgagcgtttacagtgaaacgggagac
tatggcaacgtgaaagtcagtggtgaaatccttctccatatcagctactgctacaaaact
ggtgggctgtacatttttgtcaagaattgcagaaatctggccataggagatgaaaagaaa
cagaggacagatgcttatgtcaagtcatatcttcttcctgacaagtcccggaacaacaag
cgtaagaccaaaatcagaacaggcaccaatccagaattcaatgaaacactaaagtacact
atcagccatacccagctggaaacaagaactctgcagctctcagtctggcactatgatcga
tttggacgtaatagcttcctcggggaagtagagattccttttgactcatggaactttgaa
aatccaactgatgagtggtttgtgcttcaacccaaggtggagtttgctcctgatattggc
cttcaatacaaaggagagctgacagttgttttacgttacattcccccagaagagaacctg
atgcttccaccagaacaactccaaggaaataagacttttaaaaagggaaagaagaaggag
tcacctgtaatctctggaggaatactagaagtgttcatcaaagaggcaaagaatttgaca
gcagtgaagtcaggaggcacttctgatagctttgtgaagggctacctgctccctgatgat
agcaaagccaccaagcacaaaactctggtaataaaaaagagtgttaaccctcagtggaat
catacattcatgttcagtggcatccatccccaggatataaagaatgtttgcctagaactt
actatctgggacaaggaggccttttccagcaacatctttctgggaggagttcgtttgaat
tctggaagtggtgtgagccatgggaagaacgtggattggatggactctcagggggaagag
cagcgcctttggcagaagatggccaacaaccctggaactccctttgagggtgtactcatg
cttcgttccagcatgggaaaatgtaggctctaa

DBGET integrated database retrieval system