KEGG   Homo sapiens (human): 94134
Entry
94134             CDS       T01001                                 
Symbol
ARHGAP12
Name
(RefSeq) Rho GTPase activating protein 12
  KO
K20636  Rho GTPase-activating protein 12/27
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    94134 (ARHGAP12)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    94134 (ARHGAP12)
SSDB
Motif
Pfam: SH3-WW_linker RhoGAP PH SH3_9 WW SH3_1 PH_9 DUF2255 SH3_10 Glyco_hyd_101C
Other DBs
NCBI-GeneID: 94134
NCBI-ProteinID: NP_060757
OMIM: 610577
HGNC: 16348
Ensembl: ENSG00000165322
Pharos: Q8IWW6(Tdark)
UniProt: Q8IWW6
Position
10:complement(31805398..31928876)
AA seq 846 aa
MKMADRSGKIIPGQVYIEVEYDYEYEAKDRKIVIKQGERYILVKKTNDDWWQVKPDENSK
AFYVPAQYVKEVTRKALMPPVKQVAGLPNNSTKIMQSLHLQRSTENVNKLPELSSFGKPS
SSVQGTGLIRDANQNFGPSYNQGQTVNLSLDLTHNNGKFNNDSHSPKVSSQNRTRSFGHF
PGPEFLDVEKTSFSQEQSCDSAGEGSERIHQDSESGDELSSSSTEQIRATTPPNQGRPDS
PVYANLQELKISQSALPPLPGSPAIQINGEWETHKDSSGRCYYYNRGTQERTWKPPRWTR
DASISKGDFQNPGDQELLSSEENYYSTSYSQSDSQCGSPPRGWSEELDERGHTLYTSDYT
NEKWLKHVDDQGRQYYYSADGSRSEWELPKYNASSQQQREIIKSRSLDRRLQEPIVLTKW
RHSTIVLDTNDKESPTASKPCFPENESSPSSPKHQDTASSPKDQEKYGLLNVTKIAENGK
KVRKNWLSSWAVLQGSSLLFTKTQGSSTSWFGSNQSKPEFTVDLKGATIEMASKDKSSKK
NVFELKTRQGTELLIQSDNDTVINDWFKVLSSTINNQAVETDEGIEEEIPDSPGIEKHDK
EKEQKDPKKLRSFKVSSIDSSEQKKTKKNLKKFLTRRPTLQAVREKGYIKDQVFGSNLAN
LCQRENGTVPKFVKLCIEHVEEHGLDIDGIYRVSGNLAVIQKLRFAVNHDEKLDLNDSKW
EDIHVITGALKMFFRELPEPLFTFNHFNDFVNAIKQEPRQRVAAVKDLIRQLPKPNQDTM
QILFRHLRRVIENGEKNRMTYQSIAIVFGPTLLKPEKETGNIAVHTVYQNQIVELILLEL
SSIFGR
NT seq 2541 nt   +upstreamnt  +downstreamnt
atgaaaatggctgacagaagtgggaagattattccaggacaagtgtatattgaggtggaa
tatgattatgaatatgaagcaaaggacagaaagattgtgataaaacaaggggagaggtac
atcttggtgaaaaagaccaatgatgactggtggcaagtcaagccagatgaaaactccaaa
gcgttttatgtgccagcccagtatgtgaaggaggtcacgcgcaaagctctcatgccacct
gttaagcaggtagctggtctgccaaataactccacgaaaataatgcagagtttgcatctt
cagagatcaacagaaaatgtgaacaaattgcctgagctttcaagtttcggaaagccatcg
tcatctgttcaaggaacaggtcttattcgtgatgccaatcagaattttggacccagttat
aatcaaggtcagactgtcaacctaagcctggacctgacccataataacggaaagtttaac
aatgactcacattctcctaaagtttccagccagaataggacacgctcatttggtcatttt
cccggtccagagttcttggatgtagagaaaactagcttctcccaggaacaatcttgtgat
tccgcaggagaaggctctgaaagaatacatcaagattctgaatctggtgatgaacttagc
agcagctccactgaacagataagggcaaccacacctccaaatcaaggaaggccagattct
cctgtctatgctaaccttcaagaactgaaaatatcccagtctgctcttcccccacttcct
gggagcccggcaattcagattaatggagaatgggaaactcataaagacagctcagggcgt
tgctattactataacagagggacacaggaaagaacttggaaacctcctcgttggactcgg
gatgcaagcatcagcaaaggagatttccaaaatccaggggatcaagagcttctttcatcg
gaagaaaactactacagcacttcttacagccagtcagatagtcagtgtggttctcctcca
aggggttggtcagaagagttggatgaacgtgggcataccttatataccagtgactatact
aatgaaaagtggctcaagcatgttgatgatcaaggtagacaatattactacagtgcagac
ggatctcggtcagaatgggaattgccaaagtataatgcttcatcccagcagcaaagagaa
ataattaaaagtaggagcctggacaggcggctgcaagaaccaatagtattaacaaagtgg
agacatagcaccattgtattggacactaatgataaggaatctccaactgcctcaaaaccc
tgctttcctgaaaatgagtcttctccctcctcaccaaagcaccaagatacagccagcagt
ccaaaggatcaagagaaatatggattattaaatgtaacaaaaattgctgaaaatgggaaa
aaggttcgaaagaactggttgtcttcttgggcggtgttgcagggttcatctttacttttt
accaaaactcaaggaagtagcacaagttggtttggcagtaatcagtccaaaccagagttc
acagtggacctcaagggggcaacaattgagatggcttcaaaggataaatccagcaaaaag
aatgtatttgagctgaaaactcgtcaaggaacagaactgctaattcagtctgacaatgac
actgttattaatgattggtttaaagttcttagtagtacaatcaataatcaggcagtagaa
actgatgaaggaattgaagaggagataccggattcaccaggaatagaaaagcatgataaa
gaaaaggaacaaaaggatcccaaaaagcttcgttcctttaaagtatctagcatagattct
tcagaacagaaaaaaaccaagaaaaacttaaagaagtttcttacacgacgccccactttg
caagctgttcgtgaaaaaggttatattaaagatcaggtatttggatccaatctcgctaat
ctgtgtcagagagagaatggcacagtaccaaagtttgtgaagttatgtattgaacatgtt
gaagaacatggtttggatattgatgggatatacagagtaagtggcaacctcgcagtgatc
cagaaactaaggtttgcagtcaatcatgatgagaaattggacttgaatgacagtaaatgg
gaagatattcatgtcattactggagccctcaaaatgttttttcgagaattaccagaacct
ctttttacatttaatcattttaatgattttgttaatgcaattaagcaagaaccaagacag
cgagtcgctgctgttaaggacctaatcagacagttgccaaagccaaaccaagacacaatg
cagattcttttccgacatctcagaagagttatagaaaatggagagaaaaatcgaatgacc
tatcagagtatagcaattgtttttggtcccactctattaaaaccagaaaaagagactggt
aatatagcagttcatactgtgtaccagaatcagattgtagaattaattcttctggaactg
agttccatcttcggacgttga

DBGET integrated database retrieval system