KEGG   Homo sapiens (human): 9415Help
Entry
9415              CDS       T01001                                 

Gene name
FADS2, D6D, DES6, FADSD6, LLCDL2, SLL0262, TU13
Definition
(RefSeq) fatty acid desaturase 2
  KO
K10226  acyl-CoA 6-desaturase (Delta-6 desaturase) [EC:1.14.19.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00592  alpha-Linolenic acid metabolism
hsa01040  Biosynthesis of unsaturated fatty acids
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    9415 (FADS2)
   01040 Biosynthesis of unsaturated fatty acids
    9415 (FADS2)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    9415 (FADS2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     9415 (FADS2)
Lipid biosynthesis proteins [BR:hsa01004]
 Desaturase
  Front-end
   9415 (FADS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase Cyt-b5 DUF5318
Motif
Other DBs
NCBI-GeneID: 9415
NCBI-ProteinID: NP_004256
OMIM: 606149
HGNC: 3575
Ensembl: ENSG00000134824
Vega: OTTHUMG00000163794
Pharos: O95864(Tbio)
UniProt: O95864
Position
11q12.2
AA seq 444 aa AA seqDB search
MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVI
GHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTA
EDMNLFKTNHVFFLLLLAHIIALESIAWFTVFYFGNGWIPTLITAFVLATSQAQAGWLQH
DYGHLSVYRKPKWNHLVHKFVIGHLKGASANWWNHRHFQHHAKPNIFHKDPDVNMLHVFV
LGEWQPIEYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQYQIIMTMIVHKNWVDLAWAV
SYYIRFFITYIPFYGILGALLFLNFIRFLESHWFVWVTQMNHIVMEIDQEAYRDWFSSQL
TATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLL
RALLDIIRSLKKSGKLWLDAYLHK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggggaagggagggaaccagggcgagggggccgccgagcgcgaggtgtcggtgcccacc
ttcagctgggaggagattcagaagcataacctgcgcaccgacaggtggctggtcattgac
cgcaaggtttacaacatcaccaaatggtccatccagcacccggggggccagcgggtcatc
gggcactacgctggagaagatgcaacggatgccttccgcgccttccaccctgacctggaa
ttcgtgggcaagttcttgaaacccctgctgattggtgaactggccccggaggagcccagc
caggaccacggcaagaactcaaagatcactgaggacttccgggccctgaggaagacggct
gaggacatgaacctgttcaagaccaaccacgtgttcttcctcctcctcctggcccacatc
atcgccctggagagcattgcatggttcactgtcttttactttggcaatggctggattcct
accctcatcacggcctttgtccttgctacctctcaggcccaagctggatggctgcaacat
gattatggccacctgtctgtctacagaaaacccaagtggaaccaccttgtccacaaattc
gtcattggccacttaaagggtgcctctgccaactggtggaatcatcgccacttccagcac
cacgccaagcctaacatcttccacaaggatcccgatgtgaacatgctgcacgtgtttgtt
ctgggcgaatggcagcccatcgagtacggcaagaagaagctgaaatacctgccctacaat
caccagcacgaatacttcttcctgattgggccgccgctgctcatccccatgtatttccag
taccagatcatcatgaccatgatcgtccataagaactgggtggacctggcctgggccgtc
agctactacatccggttcttcatcacctacatccctttctacggcatcctgggagccctc
cttttcctcaacttcatcaggttcctggagagccactggtttgtgtgggtcacacagatg
aatcacatcgtcatggagattgaccaggaggcctaccgtgactggttcagtagccagctg
acagccacctgcaacgtggagcagtccttcttcaacgactggttcagtggacaccttaac
ttccagattgagcaccacctcttccccaccatgccccggcacaacttacacaagatcgcc
ccgctggtgaagtctctatgtgccaagcatggcattgaataccaggagaagccgctactg
agggccctgctggacatcatcaggtccctgaagaagtctgggaagctgtggctggacgcc
taccttcacaaatga

DBGET integrated database retrieval system