KEGG   Homo sapiens (human): 9415Help
Entry
9415              CDS       T01001                                 

Gene name
FADS2, D6D, DES6, FADSD6, LLCDL2, SLL0262, TU13
Definition
(RefSeq) fatty acid desaturase 2
  KO
K10226  acyl-CoA 6-desaturase (Delta-6 desaturase) [EC:1.14.19.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00592  alpha-Linolenic acid metabolism
hsa01040  Biosynthesis of unsaturated fatty acids
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    9415 (FADS2)
   01040 Biosynthesis of unsaturated fatty acids
    9415 (FADS2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    9415 (FADS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    9415 (FADS2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     9415 (FADS2)
Lipid biosynthesis proteins [BR:hsa01004]
 Desaturase
  Front-end
   9415 (FADS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase Cyt-b5 DUF5318
Motif
Other DBs
NCBI-GeneID: 9415
NCBI-ProteinID: NP_004256
OMIM: 606149
HGNC: 3575
Ensembl: ENSG00000134824
Vega: OTTHUMG00000163794
Pharos: O95864(Tbio)
UniProt: O95864
Position
11q12.2
AA seq 444 aa AA seqDB search
MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVI
GHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTA
EDMNLFKTNHVFFLLLLAHIIALESIAWFTVFYFGNGWIPTLITAFVLATSQAQAGWLQH
DYGHLSVYRKPKWNHLVHKFVIGHLKGASANWWNHRHFQHHAKPNIFHKDPDVNMLHVFV
LGEWQPIEYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQYQIIMTMIVHKNWVDLAWAV
SYYIRFFITYIPFYGILGALLFLNFIRFLESHWFVWVTQMNHIVMEIDQEAYRDWFSSQL
TATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLL
RALLDIIRSLKKSGKLWLDAYLHK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggggaagggagggaaccagggcgagggggccgccgagcgcgaggtgtcggtgcccacc
ttcagctgggaggagattcagaagcataacctgcgcaccgacaggtggctggtcattgac
cgcaaggtttacaacatcaccaaatggtccatccagcacccggggggccagcgggtcatc
gggcactacgctggagaagatgcaacggatgccttccgcgccttccaccctgacctggaa
ttcgtgggcaagttcttgaaacccctgctgattggtgaactggccccggaggagcccagc
caggaccacggcaagaactcaaagatcactgaggacttccgggccctgaggaagacggct
gaggacatgaacctgttcaagaccaaccacgtgttcttcctcctcctcctggcccacatc
atcgccctggagagcattgcatggttcactgtcttttactttggcaatggctggattcct
accctcatcacggcctttgtccttgctacctctcaggcccaagctggatggctgcaacat
gattatggccacctgtctgtctacagaaaacccaagtggaaccaccttgtccacaaattc
gtcattggccacttaaagggtgcctctgccaactggtggaatcatcgccacttccagcac
cacgccaagcctaacatcttccacaaggatcccgatgtgaacatgctgcacgtgtttgtt
ctgggcgaatggcagcccatcgagtacggcaagaagaagctgaaatacctgccctacaat
caccagcacgaatacttcttcctgattgggccgccgctgctcatccccatgtatttccag
taccagatcatcatgaccatgatcgtccataagaactgggtggacctggcctgggccgtc
agctactacatccggttcttcatcacctacatccctttctacggcatcctgggagccctc
cttttcctcaacttcatcaggttcctggagagccactggtttgtgtgggtcacacagatg
aatcacatcgtcatggagattgaccaggaggcctaccgtgactggttcagtagccagctg
acagccacctgcaacgtggagcagtccttcttcaacgactggttcagtggacaccttaac
ttccagattgagcaccacctcttccccaccatgccccggcacaacttacacaagatcgcc
ccgctggtgaagtctctatgtgccaagcatggcattgaataccaggagaagccgctactg
agggccctgctggacatcatcaggtccctgaagaagtctgggaagctgtggctggacgcc
taccttcacaaatga

DBGET integrated database retrieval system