KEGG   Homo sapiens (human): 9419
Entry
9419              CDS       T01001                                 
Symbol
CRIPT, HSPC139, SSMDF
Name
(RefSeq) CXXC repeat containing interactor of PDZ3 domain
  KO
K24826  cysteine-rich PDZ-binding protein
Organism
hsa  Homo sapiens (human)
Disease
H02481  Syndromic disorder with short stature
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    9419 (CRIPT)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Minor spliceosome components
   Minor spliceosome associated proteins
    9419 (CRIPT)
SSDB
Motif
Pfam: Cript DZR_2 DUF2039 Rhodanese_C PLATZ
Other DBs
NCBI-GeneID: 9419
NCBI-ProteinID: NP_054890
OMIM: 604594
HGNC: 14312
Ensembl: ENSG00000119878
Pharos: Q9P021(Tbio)
UniProt: Q9P021
Structure
Position
2:46617215..46630176
AA seq 101 aa
MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRI
CKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV
NT seq 306 nt   +upstreamnt  +downstreamnt
atggtgtgcgaaaaatgtgaaaagaaacttggtactgttatcactccagatacatggaaa
gatggtgctaggaataccacagaaagtggtggaagaaagctgaatgaaaataaagctttg
acttcaaaaaaagcaagatttgatccatatggaaagaataagttctccacttgtagaatt
tgtaaaagttctgtgcaccaaccaggttctcattactgccagggctgtgcctacaaaaaa
ggcatctgtgcgatgtgtggaaaaaaggttttggataccaaaaactacaagcaaacatct
gtctag

DBGET integrated database retrieval system