KEGG   Homo sapiens (human): 942Help
Entry
942               CDS       T01001                                 

Gene name
CD86, B7-2, B7.2, B70, CD28LG2, LAB72
Definition
(RefSeq) CD86 molecule
  KO
K05413  CD86 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04620  Toll-like receptor signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05202  Transcriptional misregulation in cancer
hsa05320  Autoimmune thyroid disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
N00123  Amplified REL to transcription
N00185  KSHV MIR2 to cell surface molecule-endocytosis
Drug target
Abatacept: D03203
Belatacept: D03222
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    942 (CD86)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    942 (CD86)
   04672 Intestinal immune network for IgA production
    942 (CD86)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    942 (CD86)
  09163 Immune diseases
   05322 Systemic lupus erythematosus
    942 (CD86)
   05323 Rheumatoid arthritis
    942 (CD86)
   05320 Autoimmune thyroid disease
    942 (CD86)
   05330 Allograft rejection
    942 (CD86)
   05332 Graft-versus-host disease
    942 (CD86)
  09166 Cardiovascular diseases
   05416 Viral myocarditis
    942 (CD86)
  09167 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    942 (CD86)
  09172 Infectious diseases: Viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    942 (CD86)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    942 (CD86)
   04090 CD molecules [BR:hsa04090]
    942 (CD86)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   942 (CD86)
CD molecules [BR:hsa04090]
 Proteins
  942 (CD86)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 V-set Ig_3 LAX I-set ig DUF4381 MAP17 DUF2681
Motif
Other DBs
NCBI-GeneID: 942
NCBI-ProteinID: NP_787058
OMIM: 601020
HGNC: 1705
Ensembl: ENSG00000114013
Vega: OTTHUMG00000159482
Pharos: P42081(Tclin)
UniProt: P42081 A8K632
Structure
PDB: 

Position
3q13.33
AA seq 329 aa AA seqDB search
MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQ
ENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGM
IRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTI
EYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQ
PPPDHIPWITAVLPTVIICVMVFCLILWKWKKKKRPRNSYKCGTNTMEREESEQTKKREK
IHIPERSDEAQRVFKSSKTSSCDKSDTCF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggatccccagtgcactatgggactgagtaacattctctttgtgatggccttcctgctc
tctggtgctgctcctctgaagattcaagcttatttcaatgagactgcagacctgccatgc
caatttgcaaactctcaaaaccaaagcctgagtgagctagtagtattttggcaggaccag
gaaaacttggttctgaatgaggtatacttaggcaaagagaaatttgacagtgttcattcc
aagtatatgggccgcacaagttttgattcggacagttggaccctgagacttcacaatctt
cagatcaaggacaagggcttgtatcaatgtatcatccatcacaaaaagcccacaggaatg
attcgcatccaccagatgaattctgaactgtcagtgcttgctaacttcagtcaacctgaa
atagtaccaatttctaatataacagaaaatgtgtacataaatttgacctgctcatctata
cacggttacccagaacctaagaagatgagtgttttgctaagaaccaagaattcaactatc
gagtatgatggtattatgcagaaatctcaagataatgtcacagaactgtacgacgtttcc
atcagcttgtctgtttcattccctgatgttacgagcaatatgaccatcttctgtattctg
gaaactgacaagacgcggcttttatcttcacctttctctatagagcttgaggaccctcag
cctcccccagaccacattccttggattacagctgtacttccaacagttattatatgtgtg
atggttttctgtctaattctatggaaatggaagaagaagaagcggcctcgcaactcttat
aaatgtggaaccaacacaatggagagggaagagagtgaacagaccaagaaaagagaaaaa
atccatatacctgaaagatctgatgaagcccagcgtgtttttaaaagttcgaagacatct
tcatgcgacaaaagtgatacatgtttttaa

DBGET integrated database retrieval system