KEGG   Homo sapiens (human): 9422Help
Entry
9422              CDS       T01001                                 

Gene name
ZNF264
Definition
(RefSeq) zinc finger protein 264
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05168 Herpes simplex virus 1 infection
    9422 (ZNF264)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    9422 (ZNF264)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    9422 (ZNF264)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz zf-C2H2_6 Zn-ribbon_8 zf-C2H2_11 zf_UBZ C1_1 DUF3268 C1_4 zf-UBP Zn_Tnp_IS1595
Motif
Other DBs
NCBI-GeneID: 9422
NCBI-ProteinID: NP_003408
OMIM: 604668
HGNC: 13057
Ensembl: ENSG00000083844
Vega: OTTHUMG00000183104
Pharos: O43296(Tdark)
UniProt: O43296
Position
19q13.43
AA seq 627 aa AA seqDB search
MAAAVLTDRAQVSVTFDDVAVTFTKEEWGQLDLAQRTLYQEVMLENCGLLVSLGCPVPKA
ELICHLEHGQEPWTRKEDLSQDTCPGDKGKPKTTEPTTCEPALSEGISLQGQVTQGNSVD
SQLGQAEDQDGLSEMQEGHFRPGIDPQEKSPGKMSPECDGLGTADGVCSRIGQEQVSPGD
RVRSHNSCESGKDPMIQEEENNFKCSECGKVFNKKHLLAGHEKIHSGVKPYECTECGKTF
IKSTHLLQHHMIHTGERPYECMECGKAFNRKSYLTQHQRIHSGEKPYKCNECGKAFTHRS
NFVLHNRRHTGEKSFVCTECGQVFRHRPGFLRHYVVHSGENPYECLECGKVFKHRSYLMW
HQQTHTGEKPYECSECGKVFLESAALIHHYVIHTGEKPFECLECGKAFNHRSYLKRHQRI
HTGEKPFVCSECGKAFTHCSTFILHKRAHTGEKPFECKECGKAFSNRKDLIRHFSIHTGE
KPYECVECGKAFTRMSGLTRHKRIHSGEKPYECVECGKSFCWSTNLIRHAIIHTGEKPYK
CSECGKAFSRSSSLTQHQRMHTGKNPISVTDVGRPFTSGQTSVTLRELLLGKDFLNVTTE
ANILPEETSSSASDQPYQRETPQVSSL
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagcggtgctgacggaccgggcccaggtgtctgtgacctttgatgatgtggct
gtgactttcaccaaggaggagtgggggcagctggacctagctcagcggaccctgtaccag
gaggtgatgctggaaaactgtgggctcctggtgtctctggggtgtcctgttcccaaagct
gagctgatctgccacctagagcatgggcaggagccatggaccaggaaggaagacctctcc
caagacacctgtccaggcgacaaaggaaaacctaagaccacagaacctaccacttgtgag
ccagccttgtcagagggaatctcacttcagggacaagtgacacaaggaaactcagtggac
tcacagttggggcaagccgaggatcaggatgggctatcagaaatgcaggaaggacacttc
agaccaggaatagatccccaggagaagtctcctgggaagatgagccctgaatgtgatggt
ttagggacagctgatggtgtgtgttcaaggattggacaggagcaagtctctccaggagat
agagtccgtagccataactcatgtgagtcaggtaaagatcccatgattcaggaagaggaa
aataactttaaatgcagtgaatgtggaaaagtatttaacaagaaacacctccttgctgga
catgagaaaattcactctggagttaagccctatgaatgcacagaatgtgggaaaaccttt
attaagagcacacatctcctgcaacatcacatgatccacactggggagaggccctatgag
tgcatggagtgtggaaaggccttcaaccgcaagtcataccttacccagcaccagcggatt
cacagtggagagaagccttacaagtgcaatgaatgcggaaaggccttcacccaccgctcc
aattttgtcttgcataacaggagacacactggagaaaaatcctttgtgtgcacagaatgt
ggccaagtctttcgacataggccaggctttctccggcactatgttgtccacagtggtgag
aatccctatgagtgcttggagtgtggcaaggtcttcaaacacaggtcatatctcatgtgg
caccagcagactcataccggggagaagccctatgagtgcagtgaatgtgggaaggtcttc
ttggagagtgcagccctgattcaccactatgtcatccacactggagagaagccctttgag
tgcctcgagtgtgggaaggctttcaaccaccgatcctacctcaagaggcaccagcggatt
cacactggggagaagcccttcgtgtgcagtgaatgtggaaaggccttcacccactgctct
acttttatcttgcataaaagggcccacactggagaaaagcctttcgagtgcaaagagtgt
gggaaagcctttagcaatcggaaggacctcattcgccacttcagcatccacactggagag
aagccctatgagtgcgtggagtgtggaaaggccttcacccgcatgtcgggcctcacgagg
cacaagcggattcatagtggagagaagccctatgaatgtgttgagtgtgggaaatcgttt
tgctggagcacaaacctcattcgacatgccattatccacactggagagaagccctataaa
tgtagtgaatgtggaaaggccttcagtcgcagctcgtccctcactcagcatcaaaggatg
catactgggaaaaatcccatcagtgtaacagatgtgggaagaccttttacaagtggacaa
acctcagttacccttcgagaacttcttttagggaaggactttttgaatgtaaccactgag
gcaaatattttgccagaggaaacatcttcctctgcatctgatcaaccataccaaagagaa
accccacaagtgtcttcactgtga

DBGET integrated database retrieval system