KEGG   Homo sapiens (human): 9422
Entry
9422              CDS       T01001                                 

Gene name
ZNF264
Definition
(RefSeq) zinc finger protein 264
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_jaz Zn-ribbon_8 zf-C2H2_11 zf_UBZ zinc_ribbon_15 Requiem_N Zn_Tnp_IS1595 C1_1 HypA DUF3268 C1_4
Other DBs
NCBI-GeneID: 9422
NCBI-ProteinID: NP_003408
OMIM: 604668
HGNC: 13057
Ensembl: ENSG00000083844
Vega: OTTHUMG00000183104
Pharos: O43296(Tdark)
UniProt: O43296
Position
19q13.43
AA seq 627 aa
MAAAVLTDRAQVSVTFDDVAVTFTKEEWGQLDLAQRTLYQEVMLENCGLLVSLGCPVPKA
ELICHLEHGQEPWTRKEDLSQDTCPGDKGKPKTTEPTTCEPALSEGISLQGQVTQGNSVD
SQLGQAEDQDGLSEMQEGHFRPGIDPQEKSPGKMSPECDGLGTADGVCSRIGQEQVSPGD
RVRSHNSCESGKDPMIQEEENNFKCSECGKVFNKKHLLAGHEKIHSGVKPYECTECGKTF
IKSTHLLQHHMIHTGERPYECMECGKAFNRKSYLTQHQRIHSGEKPYKCNECGKAFTHRS
NFVLHNRRHTGEKSFVCTECGQVFRHRPGFLRHYVVHSGENPYECLECGKVFKHRSYLMW
HQQTHTGEKPYECSECGKVFLESAALIHHYVIHTGEKPFECLECGKAFNHRSYLKRHQRI
HTGEKPFVCSECGKAFTHCSTFILHKRAHTGEKPFECKECGKAFSNRKDLIRHFSIHTGE
KPYECVECGKAFTRMSGLTRHKRIHSGEKPYECVECGKSFCWSTNLIRHAIIHTGEKPYK
CSECGKAFSRSSSLTQHQRMHTGKNPISVTDVGRPFTSGQTSVTLRELLLGKDFLNVTTE
ANILPEETSSSASDQPYQRETPQVSSL
NT seq 1884 nt   +upstreamnt  +downstreamnt
atggcggcagcggtgctgacggaccgggcccaggtgtctgtgacctttgatgatgtggct
gtgactttcaccaaggaggagtgggggcagctggacctagctcagcggaccctgtaccag
gaggtgatgctggaaaactgtgggctcctggtgtctctggggtgtcctgttcccaaagct
gagctgatctgccacctagagcatgggcaggagccatggaccaggaaggaagacctctcc
caagacacctgtccaggcgacaaaggaaaacctaagaccacagaacctaccacttgtgag
ccagccttgtcagagggaatctcacttcagggacaagtgacacaaggaaactcagtggac
tcacagttggggcaagccgaggatcaggatgggctatcagaaatgcaggaaggacacttc
agaccaggaatagatccccaggagaagtctcctgggaagatgagccctgaatgtgatggt
ttagggacagctgatggtgtgtgttcaaggattggacaggagcaagtctctccaggagat
agagtccgtagccataactcatgtgagtcaggtaaagatcccatgattcaggaagaggaa
aataactttaaatgcagtgaatgtggaaaagtatttaacaagaaacacctccttgctgga
catgagaaaattcactctggagttaagccctatgaatgcacagaatgtgggaaaaccttt
attaagagcacacatctcctgcaacatcacatgatccacactggggagaggccctatgag
tgcatggagtgtggaaaggccttcaaccgcaagtcataccttacccagcaccagcggatt
cacagtggagagaagccttacaagtgcaatgaatgcggaaaggccttcacccaccgctcc
aattttgtcttgcataacaggagacacactggagaaaaatcctttgtgtgcacagaatgt
ggccaagtctttcgacataggccaggctttctccggcactatgttgtccacagtggtgag
aatccctatgagtgcttggagtgtggcaaggtcttcaaacacaggtcatatctcatgtgg
caccagcagactcataccggggagaagccctatgagtgcagtgaatgtgggaaggtcttc
ttggagagtgcagccctgattcaccactatgtcatccacactggagagaagccctttgag
tgcctcgagtgtgggaaggctttcaaccaccgatcctacctcaagaggcaccagcggatt
cacactggggagaagcccttcgtgtgcagtgaatgtggaaaggccttcacccactgctct
acttttatcttgcataaaagggcccacactggagaaaagcctttcgagtgcaaagagtgt
gggaaagcctttagcaatcggaaggacctcattcgccacttcagcatccacactggagag
aagccctatgagtgcgtggagtgtggaaaggccttcacccgcatgtcgggcctcacgagg
cacaagcggattcatagtggagagaagccctatgaatgtgttgagtgtgggaaatcgttt
tgctggagcacaaacctcattcgacatgccattatccacactggagagaagccctataaa
tgtagtgaatgtggaaaggccttcagtcgcagctcgtccctcactcagcatcaaaggatg
catactgggaaaaatcccatcagtgtaacagatgtgggaagaccttttacaagtggacaa
acctcagttacccttcgagaacttcttttagggaaggactttttgaatgtaaccactgag
gcaaatattttgccagaggaaacatcttcctctgcatctgatcaaccataccaaagagaa
accccacaagtgtcttcactgtga

DBGET integrated database retrieval system