KEGG   Homo sapiens (human): 9423
Entry
9423              CDS       T01001                                 

Symbol
NTN1, MRMV4, NTN1L
Name
(RefSeq) netrin 1
  KO
K06843  netrin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Disease
H01287  Congenital mirror movements
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    9423 (NTN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    9423 (NTN1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   9423 (NTN1)
SSDB
Motif
Pfam: Laminin_N NTR Laminin_EGF
Other DBs
NCBI-GeneID: 9423
NCBI-ProteinID: NP_004813
OMIM: 601614
HGNC: 8029
Ensembl: ENSG00000065320
Vega: OTTHUMG00000130257
Pharos: O95631(Tbio)
UniProt: O95631
Structure
PDB: 
6FKQ 4URT

Position
17p13.1
AA seq 604 aa
MMRAVWEALAALAAVACLVGAVRGGPGLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAF
GKDVRVSSTCGRPPARYCVVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCW
QSENYLQFPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQ
CRKMYNRPHRAPITKQNEQEAVCTDSHTDMRPLSGGLIAFSTLDGRPSAHDFDNSPVLQD
WVTATDIRVAFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHAARCVRDRDD
SLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLS
GRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMGKPITHRKACKACDCHPVGAAGKTCNQTT
GQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASK
GKLKINMKKYCKKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSR
DIACKCPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGK
CKKA
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgatgcgcgcagtgtgggaggcgctggcggcgctggcggcggtggcgtgcctggtgggc
gcggtgcgcggcgggcccgggctcagcatgttcgcgggccaggcggcgcagcccgatccc
tgctcggacgagaacggccacccgcgccgctgcatcccggactttgtcaatgcggccttc
ggcaaggacgtgcgcgtgtccagcacctgcggccggcccccggcgcgctactgcgtggtg
agcgagcgcggcgaggagcggctgcgctcgtgccacctctgcaacgcgtccgaccccaag
aaggcgcacccgcccgccttcctcaccgacctcaacaacccgcacaacctgacgtgctgg
cagtccgagaactacctgcagttcccgcacaacgtcacgctcacactgtccctcggcaag
aagttcgaagtgacctacgtgagcctgcagttctgctcgccgcggcccgagtccatggcc
atctacaagtccatggactacgggcgcacgtgggtgcccttccagttctactccacgcag
tgccgcaagatgtacaaccggccgcaccgcgcgcccatcaccaagcagaacgagcaggag
gccgtgtgcaccgactcgcacaccgacatgcgcccgctctcgggcggcctcatcgccttc
agcacgctggacgggcggccctcggcgcacgacttcgacaactcgcccgtgctgcaggac
tgggtcacggccacagacatccgcgtggccttcagccgcctgcacacgttcggcgacgag
aacgaggacgactcggagctggcgcgcgactcgtacttctacgcggtgtccgacctgcag
gtgggcggccggtgcaagtgcaacggccacgcggcccgctgcgtgcgcgaccgcgacgac
agcctggtgtgcgactgcaggcacaacacggccggcccggagtgcgaccgctgcaagccc
ttccactacgaccggccctggcagcgcgccacagcccgcgaagccaacgagtgcgtggcc
tgtaactgcaacctgcatgcccggcgctgccgcttcaacatggagctctacaagctttcg
gggcgcaagagcggaggtgtctgcctcaactgtcgccacaacaccgccggccgccactgc
cattactgcaaggagggctactaccgcgacatgggcaagcccatcacccaccggaaggcc
tgcaaagcctgtgattgccaccctgtgggtgctgctggcaaaacctgcaaccaaaccacc
ggccagtgtccctgcaaggacggcgtgacgggtatcacctgcaaccgctgcgccaaaggc
taccagcagagccgctctcccatcgccccctgcataaagatccctgtagcgccgccgacg
actgcagccagcagcgtggaggagcctgaagactgcgattcctactgcaaggcctccaag
gggaagctgaagattaacatgaaaaagtactgcaagaaggactatgccgtccagatccac
atcctgaaggcggacaaggcgggggactggtggaagttcacggtgaacatcatctccgtg
tataagcagggcacgagccgcatccgccgcggtgaccagagcctgtggatccgctcgcgg
gacatcgcctgcaagtgtcccaaaatcaagcccctcaagaagtacctgctgctgggcaac
gcggaggactctccggaccagagcggcatcgtggccgataaaagcagcctggtgatccag
tggcgggacacgtgggcgcggcggctgcgcaagttccagcagcgtgagaagaagggcaag
tgcaagaaggcctag

DBGET integrated database retrieval system