KEGG   Homo sapiens (human): 94239
Entry
94239             CDS       T01001                                 

Gene name
H2AZ2, H2A.Z-2, H2AFV, H2AV
Definition
(RefSeq) H2A.Z variant histone 2
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    94239 (H2AZ2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    94239 (H2AZ2)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    94239 (H2AZ2)
  09165 Substance dependence
   05034 Alcoholism
    94239 (H2AZ2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    94239 (H2AZ2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    94239 (H2AZ2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    94239 (H2AZ2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   94239 (H2AZ2)
SSDB
Motif
Pfam: Histone Histone_H2A_C CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 94239
NCBI-ProteinID: NP_036544
HGNC: 20664
Ensembl: ENSG00000105968
Vega: OTTHUMG00000129217
Pharos: Q71UI9(Tdark)
UniProt: Q71UI9
Structure
PDB: 
3WAA

Position
7p13
AA seq 128 aa
MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILE
YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG
KKGQQKTA
NT seq 387 nt   +upstreamnt  +downstreamnt
atggctggaggcaaagctggaaaggacagtgggaaggccaaggctaaggcagtatctcgc
tcacagagagctgggctacagtttcctgtgggccgcatccacagacacttgaagactcgc
accacaagccatggaagggtgggtgccactgctgccgtgtacagtgctgcgattctggag
tacctcactgcagaggtgctggagctggcaggtaatgcttctaaggatctcaaagtaaag
cgtatcactccgcgtcacttgcagcttgcaatccgtggtgatgaagagttggattctctt
atcaaggctaccatagctgggggtggtgtgatccctcacatccacaaatctctgattgga
aagaagggacagcagaaaactgcttag

DBGET integrated database retrieval system