KEGG   Homo sapiens (human): 9424Help
Entry
9424              CDS       T01001                                 

Gene name
KCNK6, K2p6.1, KCNK8, TOSS, TWIK-2, TWIK2
Definition
(RefSeq) potassium two pore domain channel subfamily K member 6
  KO
K04917  potassium channel subfamily K member 6
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (KCNK)
   9424 (KCNK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans_2 Ion_trans DUF2101
Motif
Other DBs
NCBI-GeneID: 9424
NCBI-ProteinID: NP_004814
OMIM: 603939
HGNC: 6281
Ensembl: ENSG00000099337
Vega: OTTHUMG00000182325
Pharos: Q9Y257(Tbio)
UniProt: Q9Y257 B2RDS2
Position
19q13.2
AA seq 313 aa AA seqDB search
MRRGALLAGALAAYAAYLVLGALLVARLEGPHEARLRAELETLRAQLLQRSPCVAAPALD
AFVERVLAAGRLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGK
AFSIAFALLGVPTTMLLLTASAQRLSLLLTHVPLSWLSMRWGWDPRRAACWHLVALLGVV
VTVCFLVPAVIFAHLEEAWSFLDAFYFCFISLSTIGLGDYVPGEAPGQPYRALYKVLVTV
YLFLGLVAMVLVLQTFRHVSDLHGLTELILLPPPCPASFNADEDDRVDILGPQPESHQQL
SASSHTDYASIPR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcggaggggcgcgcttctggcgggcgccttggccgcgtacgccgcgtacctggtgctg
ggcgcgctgttggtggcgcggctggaggggccgcacgaagccaggctccgagccgagctg
gagacgctgcgggcgcagctgcttcagcgcagcccgtgtgtggctgcccccgccctggac
gccttcgtggagcgagtgctggcggccggacggctggggcgggtcgtgcttgctaacgct
tcggggtccgccaacgcctcggaccccgcctgggacttcgcctctgctctcttcttcgcc
agcacgctgatcaccaccgtgggctatgggtacacaacgccactgactgatgcgggcaag
gccttctccatcgcctttgcgctcctgggcgtgccgaccaccatgctgctgctgaccgcc
tcagcccagcgcctgtcactgctgctgactcacgtgcccctgtcttggctgagcatgcgt
tggggctgggacccccggcgggcggcctgctggcacttggtggccctgttgggggtcgta
gtgaccgtctgctttctggtgccggctgtgatctttgcccacctcgaggaggcctggagc
ttcttggatgccttctacttctgctttatctctctgtccaccatcggcctgggcgactac
gtgcccggggaggcccctggccagccctaccgggccctctacaaggtgctggtcacagtc
tacctcttcctgggcctggtggccatggtgctggtgctgcagaccttccgccacgtgtcc
gacctccacggcctcacggagctcatcctgctgccccctccgtgccctgccagtttcaat
gcggatgaggacgatcgggtggacatcctgggcccccagccggagtcgcaccagcaactc
tctgccagctcccacaccgactacgcttccatccccaggtag

DBGET integrated database retrieval system