KEGG   Homo sapiens (human): 94241
Entry
94241             CDS       T01001                                 

Gene name
TP53INP1, SIP, TP53DINP1, TP53INP1A, TP53INP1B, Teap, p53DINP1
Definition
(RefSeq) tumor protein p53 inducible nuclear protein 1
  KO
K15310  tumor protein p53-inducible nuclear protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    94241 (TP53INP1)
SSDB
Motif
Pfam: DOR
Other DBs
NCBI-GeneID: 94241
NCBI-ProteinID: NP_150601
OMIM: 606185
HGNC: 18022
Ensembl: ENSG00000164938
Vega: OTTHUMG00000164697
Pharos: Q96A56(Tbio)
UniProt: Q96A56 A0A024R9C8
Position
8q22.1
AA seq 240 aa
MFQRLNKMFVGEVSSSSNQEPEFNEKEDDEWILVDFIDTCTGFSAEEEEEEEDISEESPT
EHPSVFSCLPASLECLADTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPME
NLLIEHPSMSVYAVHNSCPGLSEATRGTDELHSPSSPRVEAQNEMGQHIHCYVAALAAHT
TFLEQPKSFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPCPRQYNY
NT seq 723 nt   +upstreamnt  +downstreamnt
atgttccagaggctgaataaaatgtttgtgggtgaagtcagttcttcctccaaccaagaa
ccagaattcaatgagaaagaagatgatgaatggattcttgttgacttcatagatacttgc
actggtttctcagcagaagaagaagaagaagaggaggacatcagtgaagagtcacctact
gagcacccttcagtcttttcctgtttaccggcatctcttgagtgcttggctgatacaagt
gattcctgctttctccagtttgagtcatgtccaatggaggagagctggtttatcacccca
cccccatgttttactgcaggtggattaaccactatcaaggtggaaacaagtcctatggaa
aaccttctcattgaacatcccagcatgtctgtctatgctgtgcataactcctgccctggt
ctcagtgaggccacccgtgggactgatgaattacatagcccaagtagtcccagagtggaa
gctcaaaatgaaatggggcagcatattcattgttatgttgcagctcttgctgctcataca
acttttctggaacaacccaagagctttcgcccttcccagtggataaaagaacacagtgaa
agacagcctcttaacagaaatagccttcgtcgccaaaatcttaccagggattgccaccct
cggcaagtcaagcacaatggctgggttgttcatcagccctgcccgcgtcagtacaattac
taa

DBGET integrated database retrieval system