KEGG   Homo sapiens (human): 9437Help
Entry
9437              CDS       T01001                                 

Gene name
NCR1, CD335, LY94, NK-p46, NKP46
Definition
(RefSeq) natural cytotoxicity triggering receptor 1
  KO
K06741  natural cytotoxicity triggering receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    9437 (NCR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:hsa04090]
    9437 (NCR1)
CD molecules [BR:hsa04090]
 Proteins
  9437 (NCR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig
Motif
Other DBs
NCBI-GeneID: 9437
NCBI-ProteinID: NP_004820
OMIM: 604530
HGNC: 6731
Ensembl: ENSG00000189430
Vega: OTTHUMG00000183212
Pharos: O76036(Tbio)
UniProt: O76036 A0A0A0MQZ0
Structure
PDB: 

Position
19q13.42
AA seq 304 aa AA seqDB search
MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQL
HFEGSLFAVDRPKPPERINKVQFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEM
YDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPV
TTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTET
GLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLN
TQTL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccacactccctgccctgctctgcgtcgggctgtgtctgagtcagaggatcagc
gcccagcagcagactctcccaaaaccgttcatctgggccgagccccatttcatggttcca
aaggaaaagcaagtgaccatctgttgccagggaaattatggggctgttgaataccagctg
cactttgaaggaagcctttttgccgtggacagaccaaaaccccctgagcggattaacaaa
gtccaattctacatcccggacatgaactcccgcatggcagggcaatacagctgcatctat
cgggttggggagctctggtcagagcccagcaacttgctggatctggtggtaacagaaatg
tatgacacacccaccctctcggttcatcctggacccgaagtgatctcgggagagaaggtg
accttctactgccgtctagacactgcaacaagcatgttcttactgctcaaggagggaaga
tccagccacgtacagcgcggatacgggaaggtccaggcggagttccccctgggccctgtg
accacagcccacagagggacataccgatgttttggctcctataacaaccatgcctggtct
ttccccagtgagccagtgaagctcctggtcacaggcgacattgagaacaccagccttgca
cctgaagaccccacctttcctgcagacacttggggcacctaccttttaaccacagagacg
ggactccagaaagaccatgccctctgggatcacactgcccagaatctccttcggatgggc
ctggcctttctagtcctggtggctctagtgtggttcctggttgaagactggctcagcagg
aagaggactagagagcgagccagcagagcttccacttgggaaggcaggagaaggctgaac
acacagactctttga

DBGET integrated database retrieval system