KEGG   Homo sapiens (human): 9443Help
Entry
9443              CDS       T01001                                 

Gene name
MED7, ARC34, CRSP33, CRSP9
Definition
(RefSeq) mediator complex subunit 7
  KO
K15148  mediator of RNA polymerase II transcription subunit 7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    9443 (MED7)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Middle
     9443 (MED7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med7 DotU Nop25
Motif
Other DBs
NCBI-GeneID: 9443
NCBI-ProteinID: NP_001094286
OMIM: 605045
HGNC: 2378
Ensembl: ENSG00000155868
Vega: OTTHUMG00000130243
Pharos: O43513(Tbio)
UniProt: O43513 Q6IAZ5
Position
5q33.3
AA seq 233 aa AA seqDB search
MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLE
SQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVH
HLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEA
GMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNERP
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaaccacagcaagtgagtgcacttccaccacctccaatgcaatatatcaaggaa
tatacggatgaaaatattcaagaaggcttagctcccaagcctccccctccaataaaagac
agttacatgatgtttggcaatcagttccaatgtgatgatcttatcatccgccctttggaa
agtcagggcatcgaacggcttcatcctatgcagtttgatcacaagaaagaactgagaaaa
cttaatatgtctatccttattaatttcttggaccttttagatattttaataaggagccct
gggagtataaaacgagaagagaaactagaagatcttaagctgctttttgtacacgtgcat
catcttataaatgaataccgaccccaccaagcaagagagaccttgagagtcatgatggag
gtccagaaacgtcaacggcttgaaacagctgagagatttcaaaagcacctggaacgagta
attgaaatgattcagaattgcttggcttctttgcctgatgatttgcctcattcagaagca
ggaatgagagtaaaaactgaaccaatggatgctgatgatagcaacaattgtactggacag
aatgaacatcaaagagaaaattcaggtcataggagagatcagattatagagaaagatgct
gccttgtgtgtcctaattgatgagatgaatgaaagaccatga

DBGET integrated database retrieval system