KEGG   Homo sapiens (human): 9445Help
Entry
9445              CDS       T01001                                 

Gene name
ITM2B, ABRI, BRI, BRI2, BRICD2B, E25B, E3-16, FBD, RDGCA, imBRI2
Definition
(RefSeq) integral membrane protein 2B
  KO
K18264  integral membrane protein 2B
Organism
hsa  Homo sapiens (human)
Disease
H01184  Familial dementia
H02288  Retinal dystrophy with inner retinal dysfunction and ganglion cell abnormalities
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    9445 (ITM2B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   9445 (ITM2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BRICHOS SpoVG
Motif
Other DBs
NCBI-GeneID: 9445
NCBI-ProteinID: NP_068839
OMIM: 603904
HGNC: 6174
Ensembl: ENSG00000136156
Vega: OTTHUMG00000016894
Pharos: Q9Y287(Tbio)
UniProt: Q9Y287 A0A384MDP7
Position
13q14.2
AA seq 266 aa AA seqDB search
MVKVTFNSALAQKEAKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFG
LAFMLAGVILGGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIK
IFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNL
LELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGI
QKREASNCFAIRHFENKFAVETLICS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggtgacgttcaactccgctctggcccagaaggaggccaagaaggacgagccc
aagagcggcgaggaggcgctcatcatcccccccgacgccgtcgcggtggactgcaaggac
ccagatgatgtggtaccagttggccaaagaagagcctggtgttggtgcatgtgctttgga
ctagcatttatgcttgcaggtgttattctaggaggagcatacttgtacaaatattttgca
cttcaaccagatgacgtgtactactgtggaataaagtacatcaaagatgatgtcatctta
aatgagccctctgcagatgccccagctgctctctaccagacaattgaagaaaatattaaa
atctttgaagaagaagaagttgaatttatcagtgtgcctgtcccagagtttgcagatagt
gatcctgccaacattgttcatgactttaacaagaaacttacagcctatttagatcttaac
ctggataagtgctatgtgatccctctgaacacttccattgttatgccacccagaaaccta
ctggagttacttattaacatcaaggctggaacctatttgcctcagtcctatctgattcat
gagcacatggttattactgatcgcattgaaaacattgatcacctgggtttctttatttat
cgactgtgtcatgacaaggaaacttacaaactgcaacgcagagaaactattaaaggtatt
cagaaacgtgaagccagcaattgtttcgcaattcggcattttgaaaacaaatttgccgtg
gaaactttaatttgttcttga

DBGET integrated database retrieval system