KEGG   Homo sapiens (human): 9446
Entry
9446              CDS       T01001                                 
Symbol
GSTO1, GSTO_1-1, GSTTLp28, HEL-S-21, P28, SPG-R
Name
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis - DNA adducts
hsa05207  Chemical carcinogenesis - receptor activation
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06227  Nuclear receptor signaling
nt06250  DNA adduct formation
nt06252  Mitochondrial ROS formation
nt06263  Hepatocellular carcinoma
nt06463  Parkinson disease
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
N01365  TCDD to Ahr signaling pathway
N01386  DCE to DNA adducts
N01392  Arsenic to electron transfer in complex II
N01393  Arsenic to electron transfer in complex II
N01394  Arsenic to electron transfer in complex IV
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    9446 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    9446 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    9446 (GSTO1)
   00983 Drug metabolism - other enzymes
    9446 (GSTO1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    9446 (GSTO1)
   05204 Chemical carcinogenesis - DNA adducts
    9446 (GSTO1)
   05207 Chemical carcinogenesis - receptor activation
    9446 (GSTO1)
   05208 Chemical carcinogenesis - reactive oxygen species
    9446 (GSTO1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    9446 (GSTO1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    9446 (GSTO1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    9446 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    9446 (GSTO1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     9446 (GSTO1)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   9446 (GSTO1)
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Glutaredoxin GST_C_5
Other DBs
NCBI-GeneID: 9446
NCBI-ProteinID: NP_004823
OMIM: 605482
HGNC: 13312
Ensembl: ENSG00000148834
Pharos: P78417(Tbio)
UniProt: P78417 V9HWG9
Structure
Position
10:104254173..104267455
AA seq 241 aa
MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKP
EWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELF
SKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPW
FERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYG
L
NT seq 726 nt   +upstreamnt  +downstreamnt
atgtccggggagtcagccaggagcttggggaagggaagcgcgcccccggggccggtcccg
gagggctcgatccgcatctacagcatgaggttctgcccgtttgctgagaggacgcgtcta
gtcctgaaggccaagggaatcaggcatgaagtcatcaatatcaacctgaaaaataagcct
gagtggttctttaagaaaaatccctttggtctggtgccagttctggaaaacagtcagggt
cagctgatctacgagtctgccatcacctgtgagtacctggatgaagcatacccagggaag
aagctgttgccggatgacccctatgagaaagcttgccagaagatgatcttagagttgttt
tctaaggtgccatccttggtaggaagctttattagaagccaaaataaagaagactatgct
ggcctaaaagaagaatttcgtaaagaatttaccaagctagaggaggttctgactaataag
aagacgaccttctttggtggcaattctatctctatgattgattacctcatctggccctgg
tttgaacggctggaagcaatgaagttaaatgagtgtgtagaccacactccaaaactgaaa
ctgtggatggcagccatgaaggaagatcccacagtctcagccctgcttactagtgagaaa
gactggcaaggtttcctagagctctacttacagaacagccctgaggcctgtgactatggg
ctctga

DBGET integrated database retrieval system