KEGG   Homo sapiens (human): 945Help
Entry
945               CDS       T01001                                 

Gene name
CD33, SIGLEC-3, SIGLEC3, p67
Definition
(RefSeq) CD33 molecule
  KO
K06473  CD33 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04640  Hematopoietic cell lineage
Drug target
Gemtuzumab ozogamicin: D03259
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    945 (CD33)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:hsa04090]
    945 (CD33)
   04091 Lectins [BR:hsa04091]
    945 (CD33)
CD molecules [BR:hsa04090]
 Proteins
  945 (CD33)
Lectins [BR:hsa04091]
 I-type lectins (Siglecs)
  945 (CD33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set ig Ig_3 C2-set_2 DUF998
Motif
Other DBs
NCBI-GeneID: 945
NCBI-ProteinID: NP_001763
OMIM: 159590
HGNC: 1659
Ensembl: ENSG00000105383
Vega: OTTHUMG00000182891
Pharos: P20138(Tclin)
UniProt: P20138 Q546G0
Structure
PDB: 

Position
19q13.41
AA seq 364 aa AA seqDB search
MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYW
FREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRM
ERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWL
SAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTT
GIFPGDGSGKQETRAGVVHGAIGGAGVTALLALCLCLIFFIVKTHRRKAARTAVGRNDTH
PTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSE
VRTQ
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgctgctactgctgcccctgctgtgggcaggggccctggctatggatccaaat
ttctggctgcaagtgcaggagtcagtgacggtacaggagggtttgtgcgtcctcgtgccc
tgcactttcttccatcccataccctactacgacaagaactccccagttcatggttactgg
ttccgggaaggagccattatatccagggactctccagtggccacaaacaagctagatcaa
gaagtacaggaggagactcagggcagattccgcctccttggggatcccagtaggaacaac
tgctccctgagcatcgtagacgccaggaggagggataatggttcatacttctttcggatg
gagagaggaagtaccaaatacagttacaaatctccccagctctctgtgcatgtgacagac
ttgacccacaggcccaaaatcctcatccctggcactctagaacccggccactccaaaaac
ctgacctgctctgtgtcctgggcctgtgagcagggaacacccccgatcttctcctggttg
tcagctgcccccacctccctgggccccaggactactcactcctcggtgctcataatcacc
ccacggccccaggaccacggcaccaacctgacctgtcaggtgaagttcgctggagctggt
gtgactacggagagaaccatccagctcaacgtcacctatgttccacagaacccaacaact
ggtatctttccaggagatggctcagggaaacaagagaccagagcaggagtggttcatggg
gccattggaggagctggtgttacagccctgctcgctctttgtctctgcctcatcttcttc
atagtgaagacccacaggaggaaagcagccaggacagcagtgggcaggaatgacacccac
cctaccacagggtcagcctccccgaaacaccagaagaagtccaagttacatggccccact
gaaacctcaagctgttcaggtgccgcccctactgtggagatggatgaggagctgcattat
gcttccctcaactttcatgggatgaatccttccaaggacacctccaccgaatactcagag
gtcaggacccagtga

DBGET integrated database retrieval system