KEGG   Homo sapiens (human): 9454Help
Entry
9454              CDS       T01001                                 

Gene name
HOMER3, HOMER-3, VESL3
Definition
(RefSeq) homer scaffold protein 3
  KO
K15010  homer
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    9454 (HOMER3)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    9454 (HOMER3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WH1 Sec66 MerR-DNA-bind Reo_sigmaC AAA_13 DUF4407 Leu_zip Allexi_40kDa Phage_GP20
Motif
Other DBs
NCBI-GeneID: 9454
NCBI-ProteinID: NP_001139194
OMIM: 604800
HGNC: 17514
Ensembl: ENSG00000051128
Vega: OTTHUMG00000182995
Pharos: Q9NSC5(Tbio)
UniProt: Q9NSC5
Structure
PDB: 

Position
19p13.11
AA seq 361 aa AA seqDB search
MSTAREQPIFSTRAHVFQIDPATKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAKAII
NSTVTPNMTFTKTSQKFGQWADSRANTVYGLGFASEQHLTQFAEKFQEVKEAARLAREKS
QDGGELTSPALGLASHQVPPSPLVSANGPGEEKLFRSQSADAPGPTERERLKKMLSEGSV
GEVQWEAEFFALQDSNNKLAGALREANAAAAQWRQQLEAQRAEAERLRQRVAELEAQAAS
EVTPTGEKEGLGQGQSLEQLEALVQTKDQEIQTLKSQTGGPREALEAAEREETQQKVQDL
ETRNAELEHQLRAMERSLEEARAERERARAEVGRAAQLLDVSLFELSELREGLARLAEAA
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtccacagccagggagcagccaatcttcagcacacgggcgcacgtgttccaaattgac
ccagccaccaagcgaaactggatcccagcgggcaagcacgcactcactgtctcctatttc
tacgatgccacccgcaatgtgtaccgcatcatcagcatcggaggcgccaaggccatcatc
aacagcactgtcactcccaacatgaccttcaccaaaacttcccagaagttcgggcagtgg
gccgacagtcgcgccaacacagtctacggcctgggctttgcctctgaacagcatctgaca
cagtttgccgagaagttccaggaagtgaaggaagcagccaggctggccagggagaaatct
caggatggcggggagctcaccagtccagccctggggctcgcctcccaccaggtgcccccg
agccctctcgtcagtgccaacggccccggcgaggaaaaactgttccgcagccagagcgct
gatgcccccggccccacagagcgcgagcggctaaagaagatgttgtctgagggctccgtg
ggcgaggtacagtgggaggccgagtttttcgcactgcaggacagcaacaacaagctggca
ggcgccctgcgagaggccaacgccgccgcagcccagtggaggcagcagctggaggctcag
cgtgcagaggccgagcggctgcggcagcgggtggctgagctggaggctcaggcagcttca
gaggtgacccccaccggtgagaaggaggggctgggccagggccagtcgctggaacagctg
gaagctctggtgcaaaccaaggaccaggagattcagaccctgaagagtcagactgggggg
ccccgcgaggccctggaggctgccgagcgtgaggagactcagcagaaggtgcaggacctg
gagacccgcaatgcggagttggagcaccagctgcgggcgatggagcgcagcctggaggag
gcacgggcagagcgggagcgggcgcgggctgaggtgggccgggcagcgcagctgctggac
gtcagcctgtttgagctgagtgagctgcgtgagggcctggcccgcctggctgaggctgcg
ccctga

DBGET integrated database retrieval system