KEGG   Homo sapiens (human): 9454Help
Entry
9454              CDS       T01001                                 

Gene name
HOMER3, HOMER-3, VESL3
Definition
(RefSeq) homer scaffold protein 3
  KO
K15010  homer
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    9454 (HOMER3)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    9454 (HOMER3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WH1 Sec66 MerR-DNA-bind AAA_13 DUF4407 Leu_zip Allexi_40kDa Phage_GP20
Motif
Other DBs
NCBI-GeneID: 9454
NCBI-ProteinID: NP_001139194
OMIM: 604800
HGNC: 17514
Ensembl: ENSG00000051128
Vega: OTTHUMG00000182995
Pharos: Q9NSC5(Tbio)
UniProt: Q9NSC5
Structure
PDB: 

Position
19p13.11
AA seq 361 aa AA seqDB search
MSTAREQPIFSTRAHVFQIDPATKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAKAII
NSTVTPNMTFTKTSQKFGQWADSRANTVYGLGFASEQHLTQFAEKFQEVKEAARLAREKS
QDGGELTSPALGLASHQVPPSPLVSANGPGEEKLFRSQSADAPGPTERERLKKMLSEGSV
GEVQWEAEFFALQDSNNKLAGALREANAAAAQWRQQLEAQRAEAERLRQRVAELEAQAAS
EVTPTGEKEGLGQGQSLEQLEALVQTKDQEIQTLKSQTGGPREALEAAEREETQQKVQDL
ETRNAELEHQLRAMERSLEEARAERERARAEVGRAAQLLDVSLFELSELREGLARLAEAA
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtccacagccagggagcagccaatcttcagcacacgggcgcacgtgttccaaattgac
ccagccaccaagcgaaactggatcccagcgggcaagcacgcactcactgtctcctatttc
tacgatgccacccgcaatgtgtaccgcatcatcagcatcggaggcgccaaggccatcatc
aacagcactgtcactcccaacatgaccttcaccaaaacttcccagaagttcgggcagtgg
gccgacagtcgcgccaacacagtctacggcctgggctttgcctctgaacagcatctgaca
cagtttgccgagaagttccaggaagtgaaggaagcagccaggctggccagggagaaatct
caggatggcggggagctcaccagtccagccctggggctcgcctcccaccaggtgcccccg
agccctctcgtcagtgccaacggccccggcgaggaaaaactgttccgcagccagagcgct
gatgcccccggccccacagagcgcgagcggctaaagaagatgttgtctgagggctccgtg
ggcgaggtacagtgggaggccgagtttttcgcactgcaggacagcaacaacaagctggca
ggcgccctgcgagaggccaacgccgccgcagcccagtggaggcagcagctggaggctcag
cgtgcagaggccgagcggctgcggcagcgggtggctgagctggaggctcaggcagcttca
gaggtgacccccaccggtgagaaggaggggctgggccagggccagtcgctggaacagctg
gaagctctggtgcaaaccaaggaccaggagattcagaccctgaagagtcagactgggggg
ccccgcgaggccctggaggctgccgagcgtgaggagactcagcagaaggtgcaggacctg
gagacccgcaatgcggagttggagcaccagctgcgggcgatggagcgcagcctggaggag
gcacgggcagagcgggagcgggcgcgggctgaggtgggccgggcagcgcagctgctggac
gtcagcctgtttgagctgagtgagctgcgtgagggcctggcccgcctggctgaggctgcg
ccctga

KEGG   Homo sapiens (human): 9455Help
Entry
9455              CDS       T01001                                 

Gene name
HOMER2, ACPD, CPD, DFNA68, HOMER-2, VESL-2
Definition
(RefSeq) homer scaffold protein 2
  KO
K15010  homer
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04724  Glutamatergic synapse
Disease
H00604  Deafness, autosomal dominant
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    9455 (HOMER2)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    9455 (HOMER2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WH1 Macoilin GAS CENP-F_leu_zip MAD VGPC1_C DMPK_coil Phage_GP20 BST2 Fez1 Dor1 FPP Sec34 KASH_CCD
Motif
Other DBs
NCBI-GeneID: 9455
NCBI-ProteinID: NP_955362
OMIM: 604799
HGNC: 17513
Ensembl: ENSG00000103942
Vega: OTTHUMG00000172462
Pharos: Q9NSB8(Tbio)
UniProt: Q9NSB8
Position
15q25.2
AA seq 354 aa AA seqDB search
MGEQPIFTTRAHVFQIDPNTKKNWMPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINST
ITPNMTFTKTSQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVKEAAKIAKDKTQEK
IETSSNHSQESGRETPSSTQASSVNGTDDEKASHAGPANTHLKSENDKLKIALTQSAANV
KKWEIELQTLRESNARLTTALQESAASVEQWKRQFSICRDENDRLRNKIDELEEQCSEIN
REKEKNTQLKRRIEELEAELREKETELKDLRKQSEIIPQLMSECEYVSEKLEAAERDNQN
LEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDGKIDDLHDFRRGLSKLGTDN
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggagaacagcccatcttcaccacccgagcgcatgtcttccagattgaccccaacacc
aagaagaactggatgcctgcgagcaagcaggcggtcaccgtttcctacttctatgatgtc
acaaggaacagctatcggatcatcagtgtggacggagccaaggtgatcataaacagcaca
atcacaccgaatatgaccttcaccaaaacgtcacagaagtttgggcagtgggccgacagc
agagccaacacagtgtttggtttggggttttcctctgagcagcagctgacaaagtttgca
gagaaattccaggaggtgaaagaagctgccaagatagccaaagacaagacgcaggagaaa
atcgagacctcaagtaatcattcccaagaatctgggcgtgaaaccccatcttctactcag
gcatccagtgtcaacgggacggacgatgaaaaggcctctcacgccggtccagccaacaca
cacctgaagtctgagaatgacaagctgaagattgccttgacgcagagcgcagccaacgtg
aagaagtgggagatcgagctgcagacccttcgggagagcaatgcacggctgaccacagca
ctgcaggagtcggcagccagtgtggagcagtggaagaggcagttctccatctgccgtgat
gagaatgaccggctccgcaacaagattgatgagctggaagaacaatgcagtgagatcaac
agagagaaggagaagaacacgcagctgaagaggaggatcgaggagctggaggcagagctc
cgagaaaaggagacagagctgaaagatctccgaaaacaaagtgaaatcatacctcagctc
atgtcagagtgcgaatatgtctctgagaagctagaggcggcagagagagacaatcaaaac
ctggaagacaaagtgcgttccttaaagacagacattgaggagagcaaataccgacagcgc
cacctgaaggtggagttgaagagcttcctggaggtgctggacgggaagattgacgacctg
catgacttccgccgagggctctccaagctgggcaccgataactag

KEGG   Homo sapiens (human): 9456Help
Entry
9456              CDS       T01001                                 

Gene name
HOMER1, HOMER, HOMER1A, HOMER1B, HOMER1C, SYN47, Ves-1
Definition
(RefSeq) homer scaffold protein 1
  KO
K15010  homer
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    9456 (HOMER1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    9456 (HOMER1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WH1 HMMR_N GAS EzrA BLOC1_2 DUF1664 ATG16 FUSC Nsp1_C TMF_TATA_bd NPV_P10 Prominin DUF1465 DHR10 APG6_N
Motif
Other DBs
NCBI-GeneID: 9456
NCBI-ProteinID: NP_004263
OMIM: 604798
HGNC: 17512
Ensembl: ENSG00000152413
Vega: OTTHUMG00000134278
Pharos: Q86YM7(Tbio)
UniProt: Q86YM7 Q5U5K4
Position
5q14.1
AA seq 354 aa AA seqDB search
MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINST
ITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEK
MELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPRAEPTQNALPFSHSSAIS
KHWEAELATLKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKRVTELECVSSQAN
AVHTHKTELNQTIQELEETLKLKEEEIERLKQEIDNARELQEQRDSLTQKLQEVEIRNKD
LEGQLSDLEQRLEKSQNEQEAFRNNLKTLLEILDGKIFELTELRDNLAKLLECS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggggaacaacctatcttcagcactcgagctcatgtcttccaaattgacccaaacaca
aagaagaactgggtacccaccagcaagcatgcagttactgtgtcttatttctatgacagc
acaagaaatgtgtataggataatcagtttagatggctcaaaggcaataataaatagtacc
atcaccccaaacatgacatttactaaaacatctcagaagtttggccagtgggctgatagc
cgggcaaacaccgtttatggattgggattctcctctgagcatcatctttcgaaatttgca
gaaaagtttcaggaatttaaagaagctgctcgactagcaaaggaaaaatcacaagagaag
atggaacttaccagtacaccttcacaggaatccgcaggcggggatcttcagtctccttta
acaccggaaagtatcaacgggacagatgatgaaagaacacctgatgtgacacagaactca
gagccaagggctgaaccaactcagaatgcattgccattttcacatagttcagcaatcagc
aaacattgggaggctgaactggctaccctcaaaggaaataatgccaaactcactgcagcc
ctgctggagtccactgccaatgtgaaacaatggaaacagcaacttgctgcctatcaagag
gaagcagaacgtctgcacaagcgggtgactgaacttgaatgtgttagtagccaagcaaat
gcagtacatactcataagacagaattaaatcagacaatacaagaactggaagagacactg
aaactgaaggaagaggaaatagaaaggttaaaacaagaaattgataatgccagagaacta
caagaacagagggattctttgactcagaaactacaggaagtagaaattcggaacaaagac
ctggagggacaactgtctgacttagagcaacgtctggagaaaagtcagaatgaacaagaa
gcttttcgcaataacctgaagacactcttagaaattctggatggaaagatatttgaacta
acagaattacgagataacttggccaagctactagaatgcagctaa

DBGET integrated database retrieval system