KEGG   Homo sapiens (human): 9455
Entry
9455              CDS       T01001                                 
Symbol
HOMER2, ACPD, CPD, DFNA68, HOMER-2, VESL-2
Name
(RefSeq) homer scaffold protein 2
  KO
K15010  homer
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04724  Glutamatergic synapse
Disease
H00604  Deafness, autosomal dominant
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    9455 (HOMER2)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    9455 (HOMER2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    9455 (HOMER2)
Cilium and associated proteins [BR:hsa03037]
 Other cilia and associated proteins
  Stereociliary proteins
   9455 (HOMER2)
SSDB
Motif
Pfam: WH1 Macoilin MAD CENP-F_leu_zip CCDC22 SYCE1 DMPK_coil Phage_GP20 GAS Uso1_p115_C Crescentin CortBP2 Fez1 CLZ FPP TMF_TATA_bd
Other DBs
NCBI-GeneID: 9455
NCBI-ProteinID: NP_955362
OMIM: 604799
HGNC: 17513
Ensembl: ENSG00000103942
Pharos: Q9NSB8(Tbio)
UniProt: Q9NSB8
Position
15:complement(82834661..82986157)
AA seq 354 aa
MGEQPIFTTRAHVFQIDPNTKKNWMPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINST
ITPNMTFTKTSQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVKEAAKIAKDKTQEK
IETSSNHSQESGRETPSSTQASSVNGTDDEKASHAGPANTHLKSENDKLKIALTQSAANV
KKWEIELQTLRESNARLTTALQESAASVEQWKRQFSICRDENDRLRNKIDELEEQCSEIN
REKEKNTQLKRRIEELEAELREKETELKDLRKQSEIIPQLMSECEYVSEKLEAAERDNQN
LEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDGKIDDLHDFRRGLSKLGTDN
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggagaacagcccatcttcaccacccgagcgcatgtcttccagattgaccccaacacc
aagaagaactggatgcctgcgagcaagcaggcggtcaccgtttcctacttctatgatgtc
acaaggaacagctatcggatcatcagtgtggacggagccaaggtgatcataaacagcaca
atcacaccgaatatgaccttcaccaaaacgtcacagaagtttgggcagtgggccgacagc
agagccaacacagtgtttggtttggggttttcctctgagcagcagctgacaaagtttgca
gagaaattccaggaggtgaaagaagctgccaagatagccaaagacaagacgcaggagaaa
atcgagacctcaagtaatcattcccaagaatctgggcgtgaaaccccatcttctactcag
gcatccagtgtcaacgggacggacgatgaaaaggcctctcacgccggtccagccaacaca
cacctgaagtctgagaatgacaagctgaagattgccttgacgcagagcgcagccaacgtg
aagaagtgggagatcgagctgcagacccttcgggagagcaatgcacggctgaccacagca
ctgcaggagtcggcagccagtgtggagcagtggaagaggcagttctccatctgccgtgat
gagaatgaccggctccgcaacaagattgatgagctggaagaacaatgcagtgagatcaac
agagagaaggagaagaacacgcagctgaagaggaggatcgaggagctggaggcagagctc
cgagaaaaggagacagagctgaaagatctccgaaaacaaagtgaaatcatacctcagctc
atgtcagagtgcgaatatgtctctgagaagctagaggcggcagagagagacaatcaaaac
ctggaagacaaagtgcgttccttaaagacagacattgaggagagcaaataccgacagcgc
cacctgaaggtggagttgaagagcttcctggaggtgctggacgggaagattgacgacctg
catgacttccgccgagggctctccaagctgggcaccgataactag

DBGET integrated database retrieval system