KEGG   Homo sapiens (human): 9455Help
Entry
9455              CDS       T01001                                 

Gene name
HOMER2, ACPD, CPD, DFNA68, HOMER-2, VESL-2
Definition
(RefSeq) homer scaffold protein 2
  KO
K15010  homer
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    9455 (HOMER2)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    9455 (HOMER2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WH1 Macoilin CENP-F_leu_zip MAD Reo_sigmaC GAS VGPC1_C BST2 DMPK_coil Phage_GP20 DUF4201 FPP Fez1 Dor1 CLZ Sec34
Motif
Other DBs
NCBI-GeneID: 9455
NCBI-ProteinID: NP_955362
OMIM: 604799
HGNC: 17513
Ensembl: ENSG00000103942
Vega: OTTHUMG00000172462
Pharos: Q9NSB8(Tbio)
UniProt: Q9NSB8
Position
15q25.2
AA seq 354 aa AA seqDB search
MGEQPIFTTRAHVFQIDPNTKKNWMPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINST
ITPNMTFTKTSQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVKEAAKIAKDKTQEK
IETSSNHSQESGRETPSSTQASSVNGTDDEKASHAGPANTHLKSENDKLKIALTQSAANV
KKWEIELQTLRESNARLTTALQESAASVEQWKRQFSICRDENDRLRNKIDELEEQCSEIN
REKEKNTQLKRRIEELEAELREKETELKDLRKQSEIIPQLMSECEYVSEKLEAAERDNQN
LEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDGKIDDLHDFRRGLSKLGTDN
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggagaacagcccatcttcaccacccgagcgcatgtcttccagattgaccccaacacc
aagaagaactggatgcctgcgagcaagcaggcggtcaccgtttcctacttctatgatgtc
acaaggaacagctatcggatcatcagtgtggacggagccaaggtgatcataaacagcaca
atcacaccgaatatgaccttcaccaaaacgtcacagaagtttgggcagtgggccgacagc
agagccaacacagtgtttggtttggggttttcctctgagcagcagctgacaaagtttgca
gagaaattccaggaggtgaaagaagctgccaagatagccaaagacaagacgcaggagaaa
atcgagacctcaagtaatcattcccaagaatctgggcgtgaaaccccatcttctactcag
gcatccagtgtcaacgggacggacgatgaaaaggcctctcacgccggtccagccaacaca
cacctgaagtctgagaatgacaagctgaagattgccttgacgcagagcgcagccaacgtg
aagaagtgggagatcgagctgcagacccttcgggagagcaatgcacggctgaccacagca
ctgcaggagtcggcagccagtgtggagcagtggaagaggcagttctccatctgccgtgat
gagaatgaccggctccgcaacaagattgatgagctggaagaacaatgcagtgagatcaac
agagagaaggagaagaacacgcagctgaagaggaggatcgaggagctggaggcagagctc
cgagaaaaggagacagagctgaaagatctccgaaaacaaagtgaaatcatacctcagctc
atgtcagagtgcgaatatgtctctgagaagctagaggcggcagagagagacaatcaaaac
ctggaagacaaagtgcgttccttaaagacagacattgaggagagcaaataccgacagcgc
cacctgaaggtggagttgaagagcttcctggaggtgctggacgggaagattgacgacctg
catgacttccgccgagggctctccaagctgggcaccgataactag

DBGET integrated database retrieval system