KEGG   Homo sapiens (human): 9456Help
Entry
9456              CDS       T01001                                 

Gene name
HOMER1, HOMER, HOMER1A, HOMER1B, HOMER1C, SYN47, Ves-1
Definition
(RefSeq) homer scaffold protein 1
  KO
K15010  homer
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    9456 (HOMER1)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    9456 (HOMER1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WH1 GAS CALCOCO1 HMMR_N EzrA DUF1664 BLOC1_2 FUSC TMF_TATA_bd NPV_P10 DUF1465 APG6
Motif
Other DBs
NCBI-GeneID: 9456
NCBI-ProteinID: NP_004263
OMIM: 604798
HGNC: 17512
Ensembl: ENSG00000152413
Vega: OTTHUMG00000134278
Pharos: Q86YM7(Tbio)
UniProt: Q86YM7 Q5U5K4
Position
5q14.1
AA seq 354 aa AA seqDB search
MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINST
ITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEK
MELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPRAEPTQNALPFSHSSAIS
KHWEAELATLKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKRVTELECVSSQAN
AVHTHKTELNQTIQELEETLKLKEEEIERLKQEIDNARELQEQRDSLTQKLQEVEIRNKD
LEGQLSDLEQRLEKSQNEQEAFRNNLKTLLEILDGKIFELTELRDNLAKLLECS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggggaacaacctatcttcagcactcgagctcatgtcttccaaattgacccaaacaca
aagaagaactgggtacccaccagcaagcatgcagttactgtgtcttatttctatgacagc
acaagaaatgtgtataggataatcagtttagatggctcaaaggcaataataaatagtacc
atcaccccaaacatgacatttactaaaacatctcagaagtttggccagtgggctgatagc
cgggcaaacaccgtttatggattgggattctcctctgagcatcatctttcgaaatttgca
gaaaagtttcaggaatttaaagaagctgctcgactagcaaaggaaaaatcacaagagaag
atggaacttaccagtacaccttcacaggaatccgcaggcggggatcttcagtctccttta
acaccggaaagtatcaacgggacagatgatgaaagaacacctgatgtgacacagaactca
gagccaagggctgaaccaactcagaatgcattgccattttcacatagttcagcaatcagc
aaacattgggaggctgaactggctaccctcaaaggaaataatgccaaactcactgcagcc
ctgctggagtccactgccaatgtgaaacaatggaaacagcaacttgctgcctatcaagag
gaagcagaacgtctgcacaagcgggtgactgaacttgaatgtgttagtagccaagcaaat
gcagtacatactcataagacagaattaaatcagacaatacaagaactggaagagacactg
aaactgaaggaagaggaaatagaaaggttaaaacaagaaattgataatgccagagaacta
caagaacagagggattctttgactcagaaactacaggaagtagaaattcggaacaaagac
ctggagggacaactgtctgacttagagcaacgtctggagaaaagtcagaatgaacaagaa
gcttttcgcaataacctgaagacactcttagaaattctggatggaaagatatttgaacta
acagaattacgagataacttggccaagctactagaatgcagctaa

DBGET integrated database retrieval system