KEGG   Homo sapiens (human): 9459Help
Entry
9459              CDS       T01001                                 

Gene name
ARHGEF6, COOL2, Cool-2, MRX46, PIXA, alpha-PIX, alphaPIX
Definition
(RefSeq) Rac/Cdc42 guanine nucleotide exchange factor 6
  KO
K05729  Rho guanine nucleotide exchange factor 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
hsa05212  Pancreatic cancer
Disease
H00480  X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    9459 (ARHGEF6)
 09160 Human Diseases
  09162 Cancers: Specific types
   05212 Pancreatic cancer
    9459 (ARHGEF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9459 (ARHGEF6)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    9459 (ARHGEF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGEF67_u2 betaPIX_CC RhoGEF CH SH3_9 SH3_2 RhoGEF67_u1 SH3_1 PH CAMSAP_CH ZapB FCH
Motif
Other DBs
NCBI-GeneID: 9459
NCBI-ProteinID: NP_004831
OMIM: 300267
HGNC: 685
Ensembl: ENSG00000129675
Vega: OTTHUMG00000022518
Pharos: Q15052(Tbio)
UniProt: Q15052 Q8N4Q3
Structure
PDB: 

Position
Xq26.3
AA seq 776 aa AA seqDB search
MNPEEQIVTWLISLGVLESPKKTICDPEEFLKSSLKNGVVLCKLINRLMPGSVEKFCLDP
QTEADCINNINDFLKGCATLQVEIFDPDDLYSGVNFSKVLSTLLAVNKATEDQLSERPCG
RSSSLSAANTSQTNPQGAVSSTVSGLQRQSKTVEMTENGSHQLIVKARFNFKQTNEDELS
VCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIKSSERPLSPKAVKGFETAPLTKN
YYTVVLQNILDTEKEYAKELQSLLVTYLRPLQSNNNLSTVEVTSLLGNFEEVCTFQQTLC
QALEECSKFPENQHKVGGCLLSLMPHFKSMYLAYCANHPSAVNVLTQHSDELEQFMENQG
ASSPGILILTTNLSKPFMRLEKYVTLLQELERHMEDTHPDHQDILKAIVAFKTLMGQCQD
LRKRKQLELQILSEPIQAWEGEDIKNLGNVIFMSQVMVQYGACEEKEERYLMLFSNVLIM
LSASPRMSGFIYQGKIPIAGTVVTRLDEIEGNDCTFEITGNTVERIVVHCNNNQDFQEWL
EQLNRLIRGPASCSSLSKTSSSSCSAHSSFSSTGQPRGPLEPPQIIKPWSLSCLRPAPPL
RPSAALGYKERMSYILKESSKSPKTMKKFLHKRKTERKPSEEEYVIRKSTAALEEDAQIL
KVIEAYCTSANFQQGHGSSTRKDSIPQVLLPEEEKLIIEETRSNGQTIMEEKSLVDTVYA
LKDEVRELKQENKRMKQCLEEELKSRRDLEKLVRRLLKQTDECIRGESSSKTSILP
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgaatccagaagaacaaatcgtgacatggcttatatctttgggagttttagagtcccct
aaaaagaccatctgtgatccggaggagtttttaaagtcctcgctgaaaaatggggtagtt
ctgtgcaaactgatcaacagactcatgcctggctctgtggaaaagttttgtctggatccc
caaactgaagctgactgcatcaacaacatcaatgacttcctgaaaggatgtgcaaccctc
caagtggaaatatttgatcctgatgacctttattcaggggtcaatttctccaaggtactg
agtactcttttagctgtcaacaaagcaacagaagatcagctatcagaaagaccatgtgga
cgttcctcttctcttagtgctgctaatacttctcagacaaacccacagggagcagtttct
agcacagtttcagggctgcaaaggcagtcaaagacagtggagatgacggaaaatggaagt
catcagttgatagtaaaagcaagattcaactttaagcagactaatgaggatgaactgtca
gtttgtaagggggacatcatttacgtcacacgagttgaagaaggaggctggtgggaaggc
acattaaatgggagaacaggctggttccccagtaattatgtccgtgaaattaaatccagt
gagagacctctctccccaaaagccgtcaaaggatttgaaactgctccacttaccaagaat
tattatactgtggtgttacagaacatcctggacactgaaaaagaatatgctaaagaactt
cagtctcttcttgttacttacttaagacccctgcagtccaataacaatctgagtactgtg
gaggttacatctttactgggaaacttcgaggaagtatgcacatttcaacagacactctgc
caagccttggaagaatgttcaaagtttccagaaaaccagcacaaagtaggaggttgtcta
ctgagtctcatgcctcattttaaatctatgtatctggcttactgtgcaaaccatccttca
gctgtaaatgtgctcactcagcacagtgatgagttggaacaattcatggaaaatcaaggt
gcatcgagcccaggtatcctcattttaacaacaaacctcagcaaaccattcatgcgactg
gagaaatatgttactctcttgcaagagttagaacggcatatggaggatactcatccagat
catcaggatattctgaaagcaatcgtagcattcaaaactctcatggggcaatgtcaagat
ctgaggaagagaaaacagctggagttacagatactgtccgaacctattcaggcatgggaa
ggagaagatattaaaaacttgggaaatgtgatttttatgtcacaagtaatggtgcagtat
ggagcatgtgaggaaaaagaggagcggtaccttatgttattttcaaatgtcctgataatg
ttatctgcaagtcctcggatgagtggctttatctatcagggaaaaataccaatagcagga
acggtggtgactagattagatgaaattgaagggaatgactgcacatttgaaatcactggt
aacacagtggagagaattgtggtccattgtaacaacaaccaggacttccaggaatggttg
gagcagctgaacagactgatcagaggacctgcctcttgcagttcattatccaaaacctca
tcgtcatcatgtagtgctcattcttcttttagctctaccggacagccccgaggacccttg
gagcctcctcaaattataaaaccgtggagtttaagttgtctacgacctgcacctccactt
agaccatcagcagcactaggttataaagagaggatgtcttatatcttaaaggagtctagt
aaaagccctaaaacgatgaagaaatttcttcataaaaggaagactgagagaaaaccatcg
gaggaggaatatgtgattaggaaaagtacagctgctctggaagaggatgctcaaatcctt
aaagtgatcgaagcctactgcaccagcgcaaattttcaacaaggccatggctcaagtact
cgaaaagattccattccacaagtcctactccctgaggaagagaaactcatcattgaagaa
accagaagcaacggccagaccatcatggaagaaaagagccttgttgatactgtttacgcc
ttgaaggacgaggtcagagaactgaagcaggaaaataaaagaatgaagcaatgcctggaa
gaagaactgaaatcaagaagggacctagaaaagctggtgcggaggcttttgaagcaaaca
gatgagtgtattcgaggcgagtccagtagcaagacctcaattcttccataa

DBGET integrated database retrieval system