KEGG   Homo sapiens (human): 946Help
Entry
946               CDS       T01001                                 

Gene name
SIGLEC6, CD327, CD33L, CD33L1, CD33L2, CDW327, OBBP1
Definition
(RefSeq) sialic acid binding Ig like lectin 6
  KO
K06738  sialic acid binding Ig-like lectin 6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    946 (SIGLEC6)
   04091 Lectins [BR:hsa04091]
    946 (SIGLEC6)
CD molecules [BR:hsa04090]
 Proteins
  946 (SIGLEC6)
Lectins [BR:hsa04091]
 I-type lectins (Siglecs)
  946 (SIGLEC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 V-set ig Ig_2 I-set C2-set_2
Motif
Other DBs
NCBI-GeneID: 946
NCBI-ProteinID: NP_001236
OMIM: 604405
HGNC: 10875
Ensembl: ENSG00000105492
Vega: OTTHUMG00000133571
Pharos: O43699(Tbio)
UniProt: O43699 A0A024R4K4
Position
19q13.41
AA seq 453 aa AA seqDB search
MQGAQEASASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVPCRLPTTLPAS
YYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYF
FRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIF
SWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSYAPQK
VAISIFQGNSAAFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISN
TGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGVLGAVWGASITTLV
FLCVCFIFRVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISED
EQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcagggagcccaggaagcctccgcctcagagatgctaccgctgctgctgcccctgctg
tgggcaggggccctggctcaggagcggagattccagctggaggggccagagtcactgacg
gtgcaggagggtctgtgcgtcctcgtaccctgcagattgcccactacccttccagcctcg
tactatggttatggctactggttcctggaaggggctgatgttccagtggccacaaacgac
ccagacgaagaagtgcaggaggagacccggggccgattccacctcctctgggatcccaga
aggaagaactgctccctgagcatcagagatgcccggaggagggacaatgctgcatacttc
tttcggttgaagtccaaatggatgaaatacggttatacatcttccaagctctctgtgcgt
gtgatggccctgacccacaggcccaacatctccatcccagggaccctggagtctggccat
cccagcaatctgacctgctctgtgccctgggtctgtgagcaggggacgccccccatcttc
tcctggatgtcagctgcccccacctccctgggccccaggaccacccagtcctcggtgctc
acaatcaccccacggccccaggaccacagcaccaacctcacctgtcaggtgacgttccct
ggagccggtgtgaccatggagagaaccatccagctcaatgtctcctatgctccacagaaa
gtggccatcagcatcttccaaggaaacagcgcagccttcaaaatcctgcaaaacacctcg
tccctccctgtcctggagggccaggctctgcggctgctctgtgatgctgacggcaacccc
cctgcacacctgagctggttccagggcttccccgccctgaacgccacccccatctccaat
accggggtcctggagctgcctcaagtagggtctgcagaagaaggagatttcacctgccgt
gctcagcatcctctgggctccctgcaaatctctctgagtctctttgtgcattggaaacca
gaaggcagggctggtggtgtcctgggagcagtctggggagctagcatcacaaccctggtt
ttcctctgtgtttgcttcatcttcagagtgaagactagaaggaagaaagcagcccagcca
gtgcaaaacacggatgatgtgaaccccgtcatggtctcaggctccaggggtcatcagcac
cagttccagacaggcatagtttcagaccaccctgctgaggctggccccatctcagaagat
gagcaggagctccactacgctgtcctacacttccacaaggtgcaacctcaggaaccaaag
gtcaccgacactgagtactcagaaatcaagatacacaagtga

DBGET integrated database retrieval system