KEGG   Homo sapiens (human): 9463
Entry
9463              CDS       T01001                                 

Gene name
PICK1, PICK, PRKCABP
Definition
(RefSeq) protein interacting with PRKCA 1
  KO
K24062  PRKCA-binding protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    9463 (PICK1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 PDZ domain-containing proteins
  Other PDZ domain-containing proteins
   9463 (PICK1)
SSDB
Motif
Pfam: Arfaptin PDZ PDZ_6 BAR PDZ_2 DUF6288 DALR_1 GRASP55_65
Other DBs
NCBI-GeneID: 9463
NCBI-ProteinID: NP_001034672
OMIM: 605926
HGNC: 9394
Ensembl: ENSG00000100151
Vega: OTTHUMG00000151159
Pharos: Q9NRD5(Tbio)
UniProt: Q9NRD5 A0A024R1J5
Structure
PDB: 
2GZV 6AR4 6BJO 6BJN

Position
22q13.1
AA seq 415 aa
MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAAL
DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKK
VKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYEL
SQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLN
KAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRC
RQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPI
EVDLAHTTLAYGLNQEEFTDGEEEEEEEDTAAGEPSRDTRGAAGPLDKGGSWCDS
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgtttgcagacttggattatgacatcgaagaggataaactcggaatcccgactgtgcct
gggaaggtgaccctgcagaaggatgctcagaacctgatcgggatcagcattggaggaggg
gcccagtactgtccctgcctctatatcgtccaggtatttgacaacaccccagcagccttg
gacggcacagtggcagctggcgatgagatcaccggtgtcaatggcaggtcaatcaaaggg
aaaactaaggtggaggtggcgaagatgattcaggaggtgaagggggaggtgaccatccac
tacaacaagctgcaggcggaccccaagcagggcatgtccctggacattgtgttgaagaaa
gtcaagcaccggctggtggagaacatgagttcagggaccgcagatgctctgggcctgagc
cgggccatcctgtgcaatgatgggcttgtcaagaggctagaggagctggagcggaccgct
gagctatacaaagggatgacggaacacaccaagaacctcctacgggccttttatgagctg
tcgcagactcaccgggcctttggggacgtgttctccgtgatcggggtgcgggagccccag
ccagctgcgagcgaggcttttgtgaagttcgccgatgcccaccgcagcatcgagaagttc
ggcattcggcttctgaaaaccatcaagccgatgctgacggatctgaacacgtacctcaac
aaagccatcccggacactcgcctcaccatcaagaagtacctggacgtgaagtttgagtac
ctgtcgtactgcctgaaggtgaaggagatggatgacgaggaatacagctgcattgcccta
ggcgagcccctttaccgggtgagcaccggcaactatgagtaccgcctgatcctgcgctgc
cgccaggaggcgcgcgcccgcttctcccagatgcgcaaggatgtgctggagaagatggag
ctgctggaccagaagcacgtccaggacatcgtgttccagctgcagcgcctcgtgtccacc
atgtccaagtactacaacgactgctacgcagtgctgcgggatgccgacgtcttccccatc
gaggtagacctggcgcacaccacattggcctatggcctcaaccaggaggagttcacagat
ggggaggaggaggaggaggaggaagacacggcagctggggagccgtccagggatacacga
ggggctgctgggcccttggacaagggtggaagctggtgtgactcctga

DBGET integrated database retrieval system