KEGG   Homo sapiens (human): 9463Help
Entry
9463              CDS       T01001                                 

Gene name
PICK1, PICK, PRKCABP
Definition
(RefSeq) protein interacting with PRKCA 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Arfaptin PDZ PDZ_6 BAR PDZ_2 BAR_3 DALR_1 GRASP55_65
Motif
Other DBs
NCBI-GeneID: 9463
NCBI-ProteinID: NP_001034672
OMIM: 605926
HGNC: 9394
Ensembl: ENSG00000100151
Vega: OTTHUMG00000151159
Pharos: Q9NRD5(Tbio)
UniProt: Q9NRD5 A0A024R1J5
Structure
PDB: 

Position
22q13.1
AA seq 415 aa AA seqDB search
MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAAL
DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKK
VKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYEL
SQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLN
KAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRC
RQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPI
EVDLAHTTLAYGLNQEEFTDGEEEEEEEDTAAGEPSRDTRGAAGPLDKGGSWCDS
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcagacttggattatgacatcgaagaggataaactcggaatcccgactgtgcct
gggaaggtgaccctgcagaaggatgctcagaacctgatcgggatcagcattggaggaggg
gcccagtactgtccctgcctctatatcgtccaggtatttgacaacaccccagcagccttg
gacggcacagtggcagctggcgatgagatcaccggtgtcaatggcaggtcaatcaaaggg
aaaactaaggtggaggtggcgaagatgattcaggaggtgaagggggaggtgaccatccac
tacaacaagctgcaggcggaccccaagcagggcatgtccctggacattgtgttgaagaaa
gtcaagcaccggctggtggagaacatgagttcagggaccgcagatgctctgggcctgagc
cgggccatcctgtgcaatgatgggcttgtcaagaggctagaggagctggagcggaccgct
gagctatacaaagggatgacggaacacaccaagaacctcctacgggccttttatgagctg
tcgcagactcaccgggcctttggggacgtgttctccgtgatcggggtgcgggagccccag
ccagctgcgagcgaggcttttgtgaagttcgccgatgcccaccgcagcatcgagaagttc
ggcattcggcttctgaaaaccatcaagccgatgctgacggatctgaacacgtacctcaac
aaagccatcccggacactcgcctcaccatcaagaagtacctggacgtgaagtttgagtac
ctgtcgtactgcctgaaggtgaaggagatggatgacgaggaatacagctgcattgcccta
ggcgagcccctttaccgggtgagcaccggcaactatgagtaccgcctgatcctgcgctgc
cgccaggaggcgcgcgcccgcttctcccagatgcgcaaggatgtgctggagaagatggag
ctgctggaccagaagcacgtccaggacatcgtgttccagctgcagcgcctcgtgtccacc
atgtccaagtactacaacgactgctacgcagtgctgcgggatgccgacgtcttccccatc
gaggtagacctggcgcacaccacattggcctatggcctcaaccaggaggagttcacagat
ggggaggaggaggaggaggaggaagacacggcagctggggagccgtccagggatacacga
ggggctgctgggcccttggacaagggtggaagctggtgtgactcctga

DBGET integrated database retrieval system