KEGG   Homo sapiens (human): 9468Help
Entry
9468              CDS       T01001                                 

Gene name
PCYT1B, CCTB, CTB
Definition
(RefSeq) phosphate cytidylyltransferase 1, choline, beta
  KO
K00968  choline-phosphate cytidylyltransferase [EC:2.7.7.15]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00440  Phosphonate and phosphinate metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa05231  Choline metabolism in cancer
Module
hsa_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    9468 (PCYT1B)
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    9468 (PCYT1B)
 09160 Human Diseases
  09161 Cancers: Overview
   05231 Choline metabolism in cancer
    9468 (PCYT1B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.15  choline-phosphate cytidylyltransferase
     9468 (PCYT1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like Lipoprotein_6 YtxH
Motif
Other DBs
NCBI-GeneID: 9468
NCBI-ProteinID: NP_004836
OMIM: 300948
HGNC: 8755
Ensembl: ENSG00000102230
Vega: OTTHUMG00000021270
Pharos: Q9Y5K3(Tbio)
UniProt: Q9Y5K3
Position
Xp22.11
AA seq 369 aa AA seqDB search
MPVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHE
KLTIAQARLGTPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHK
FKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDD
VYKHIKEAGMFVPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKRY
RFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGPDGAWK
QMFQERSSRMLQALSPKQSPVSSPTRSRSPSRSPSPTFSWLPLKTSPPSSPKAASASISS
MSEGDEDEK
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgccagtagttaccactgatgctgagtcagaaacaggtatcccaaaatccctttccaat
gagcctccctcagaaaccatggaggaaatagagcacacatgcccacagcctcgactgacc
ctgactgcacctgccccatttgctgatgaaaccaactgccagtgtcaagcaccccatgaa
aaactgaccattgctcaggcccgcttaggaacaccagctgacaggcctgtcagagtatac
gccgatggaatatttgacctcttccactcaggtcatgcaagagcccttatgcaagcaaaa
acactgtttcccaacagctacttgttggtaggagtttgcagtgatgatctcacccacaaa
ttcaaaggtttcaccgtgatgaatgaagccgagagatacgaagctctcagacactgtcgc
tacgtagacgaagttatcagagatgctccctggacactcacgccagagtttctggaaaaa
cacaagattgactttgtggctcatgatgacattccgtattcctctgctggctctgatgat
gtttacaagcacataaaggaagcagggatgttcgttccaacgcagagaacagaaggcatc
tcaacatcggacatcattaccagaattgttcgtgactatgatgtttatgcccgacgtaac
ctccagagagggtatacagccaaggaactgaatgtcagctttataaatgagaagaggtac
cgtttccagaaccaagtggacaaaatgaaggaaaaagtcaagaatgtggaggaaagatca
aaggaatttgtgaacagagtggaagaaaagagccatgatctaattcaaaagtgggaagag
aagtcaagggaattcattggcaacttcctagaactgtttggacctgatggagcatggaag
cagatgttccaggagaggagcagccggatgctgcaggccttatccccgaagcagagccct
gtgagcagcccaacccggagccggtccccttcccgctccccatcgcccaccttctcatgg
cttccactcaaaacctcacccccttcctcacccaaagcagcctcagcctctatcagcagc
atgagcgagggggatgaggatgaaaagtag

DBGET integrated database retrieval system