KEGG   Homo sapiens (human): 9474Help
Entry
9474              CDS       T01001                                 

Gene name
ATG5, APG5, APG5-LIKE, APG5L, ASP, SCAR25, hAPG5
Definition
(RefSeq) autophagy related 5
  KO
K08339  autophagy-related protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04216  Ferroptosis
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    9474 (ATG5)
   04136 Autophagy - other eukaryotes
    9474 (ATG5)
   04137 Mitophagy - animal
    9474 (ATG5)
  Cell growth and death
   04216 Ferroptosis
    9474 (ATG5)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    9474 (ATG5)
   04622 RIG-I-like receptor signaling pathway
    9474 (ATG5)
  Aging
   04211 Longevity regulating pathway - mammal
    9474 (ATG5)
   04213 Longevity regulating pathway - multiple species
    9474 (ATG5)
 Human Diseases
  Infectious diseases
   05131 Shigellosis
    9474 (ATG5)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    9474 (ATG5)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    9474 (ATG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: APG5
Motif
Other DBs
NCBI-GeneID: 9474
NCBI-ProteinID: NP_001273035
OMIM: 604261
HGNC: 589
Ensembl: ENSG00000057663
Vega: OTTHUMG00000016193
Pharos: Q9H1Y0(Tbio)
UniProt: Q9H1Y0 A9UGY9 Q7Z3H3
Structure
PDB: 

Position
6q21
AA seq 275 aa AA seqDB search
MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVM
RQEDISEIWFEYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDA
IEAHFMSCMKEADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEEN
GFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMI
HGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgacagatgacaaagatgtgcttcgagatgtgtggtttggacgaattccaacttgtttc
acgctatatcaggatgagataactgaaagggaagcagaaccatactatttgcttttgcca
agagtaagttatttgacgttggtaactgacaaagtgaaaaagcactttcagaaggttatg
agacaagaagacattagtgagatatggtttgaatatgaaggcacaccactgaaatggcat
tatccaattggtttgctatttgatcttcttgcatcaagttcagctcttccttggaacatc
acagtacattttaagagttttccagaaaaagaccttctgcactgtccatctaaggatgca
attgaagctcattttatgtcatgtatgaaagaagctgatgctttaaaacataaaagtcaa
gtaatcaatgaaatgcagaaaaaagatcacaagcaactctggatgggattgcaaaatgac
agatttgaccagttttgggccatcaatcggaaactcatggaatatcctgcagaagaaaat
ggatttcgttatatcccctttagaatatatcagacaacgactgaaagacctttcattcag
aagctgtttcgtcctgtggctgcagatggacagttgcacacactaggagatctcctcaaa
gaagtttgtccttctgctattgatcctgaagatggggaaaaaaagaatcaagtgatgatt
catggaattgagccaatgttggaaacacctctgcagtggctgagtgaacatctgagctac
ccggataattttcttcatattagtatcatcccacagccaacagattga

DBGET integrated database retrieval system