KEGG   Homo sapiens (human): 9476Help
Entry
9476              CDS       T01001                                 

Gene name
NAPSA, KAP, Kdap, NAP1, NAPA, SNAPA
Definition
(RefSeq) napsin A aspartic peptidase
  KO
K08565  napsin-A [EC:3.4.23.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    9476 (NAPSA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    9476 (NAPSA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     9476 (NAPSA)
Peptidases and inhibitors [BR:hsa01002]
 Aspartic peptidases
  Family A1: pepsin family
   9476 (NAPSA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asp TAXi_N A1_Propeptide
Motif
Other DBs
NCBI-GeneID: 9476
NCBI-ProteinID: NP_004842
OMIM: 605631
HGNC: 13395
Ensembl: ENSG00000131400
Vega: OTTHUMG00000183035
Pharos: O96009(Tbio)
UniProt: O96009
Position
19q13.33
AA seq 420 aa AA seqDB search
MSPPPLLQPLLLLLPLLNVEPSGATLIRIPLHRVQPGRRILNLLRGWREPAELPKLGAPS
PGDKPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHH
RFDPKASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAF
AHFDGILGLGFPILSVEGVRPPMDVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGSDP
AHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTLCAKGCAAILDTGTSLITGPTEEIRALH
AAIGGIPLLAGEYIILCSEIPKLPAVSFLLGGVWFNLTAHDYVIQTTRNGVRLCLSGFQA
LDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQAQFPG
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtctccaccaccgctgctgcaacccctgctgctgctgctgcctctgctgaatgtggag
ccttccggggccacactgatccgcatccctcttcatcgagtccaacctggacgcaggatc
ctgaacctactgaggggatggagagaaccagcagagctccccaagttgggggccccatcc
cctggggacaagcccatcttcgtacctctctcgaactacagggatgtgcagtattttggg
gaaattgggctgggaacgcctccacaaaacttcactgttgcctttgacactggctcctcc
aatctctgggtcccgtccaggagatgccacttcttcagtgtgccctgctggttacaccac
cgatttgatcccaaagcctctagctccttccaggccaatgggaccaagtttgccattcaa
tatggaactgggcgggtagatggaatcctgagcgaggacaagctgactattggtggaatc
aagggtgcatcagtgattttcggggaggctctctgggagcccagcctggtcttcgctttt
gcccattttgatgggatattgggcctcggttttcccattctgtctgtggaaggagttcgg
cccccgatggatgtactggtggagcaggggctattggataagcctgtcttctccttttac
ctcaacagggaccctgaagagcctgatggaggagagctggtcctggggggctcggacccg
gcacactacatcccacccctcaccttcgtgccagtcacggtccctgcctactggcagatc
cacatggagcgtgtgaaggtgggcccagggctgactctctgtgccaagggctgtgctgcc
atcctggatacgggcacgtccctcatcacaggacccactgaggagatccgggccctgcat
gcagccattgggggaatccccttgctggctggggagtacatcatcctgtgctcggaaatc
ccaaagctccccgcagtctccttccttcttgggggggtctggtttaacctcacggcccat
gattacgtcatccagactactcgaaatggcgtccgcctctgcttgtccggtttccaggcc
ctggatgtccctccgcctgcagggcccttctggatcctcggtgacgtcttcttggggacg
tatgtggccgtcttcgaccgcggggacatgaagagcagcgcccgggtgggcctggcgcgc
gctcgcactcgcggagcggacctcggatggggagagactgcgcaggcgcagttccccggg
tga

DBGET integrated database retrieval system