KEGG   Homo sapiens (human): 9478
Entry
9478              CDS       T01001                                 

Gene name
CABP1, CALBRAIN, HCALB_BR
Definition
(RefSeq) calcium binding protein 1
  KO
K23531  calcium-binding protein 1/2/4/5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9478 (CABP1)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    9478 (CABP1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    9478 (CABP1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 EF-hand domain-containing proteins
  Calcium binding proteins
   9478 (CABP1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 Dockerin_1 SPARC_Ca_bdg DIMCO_N EF-hand_4 POTRA_2
Other DBs
NCBI-GeneID: 9478
NCBI-ProteinID: NP_001028849
OMIM: 605563
HGNC: 1384
Ensembl: ENSG00000157782
Vega: OTTHUMG00000156794
Pharos: Q9NZU7(Tbio)
UniProt: Q9NZU7
Structure
PDB: 

Position
12q24.31
AA seq 370 aa
MGGGDGAAFKRPGDGARLQRVLGLGSRREPRSLPAGGPAPRRTAPPPPGHASAGPAAMSS
HIAKSESKTSLLKAAAAAASGGSRAPRHGPARDPGLPSRRLPGSCPATPQSSGDPSSRRP
LCRPAPREEGARGSQRVLPQAHCRPREALPAAASRPSPSSPLPPARGRDGEERGLSPALG
LRGSLRARGRGDSVPAAASEADPFLHRLRPMLSSAFGQDRSLRPEEIEELREAFREFDKD
KDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDFVELMGPKLLAETAD
MIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVD
FEEFVRMMSR
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgggcggcggcgacggggccgcatttaagcggccgggggacggcgcccgcctccagcgc
gtcctcgggcttggctcccgccgggagccccgttctctgcccgccgggggccccgcgccg
cgccgcaccgcgccgcccccgccgggccatgcgagcgcgggccccgccgcgatgagctcg
cacatcgccaaaagcgagtccaagacgtcgctgctgaaggcggcggcggcggcggcgagc
gggggcagccgggctccccgccacggccctgcccgggacccggggctgcctagccgccgg
ctacccggctcctgcccggcgacgccgcagtcgtccggggaccccagttcgcggaggccc
ctgtgccggccggcgccgcgagaggagggcgcgcgggggagccagcgtgtgctcccccag
gcgcactgcaggccccgggaggcgctgccggccgcggcgtcccgaccttcgccgtcgtcg
ccgctgccgccggcccgcgggcgggatggggaggaacggggactgtccccggcgctcggc
ctccggggctctctgcgagcccggggccgcggggactccgttccagccgccgcgtccgag
gcggacccgttcctccaccggctgcgccccatgctcagctccgcctttggccaggataga
tcactgcgaccagaggaaattgaagagctccgagaggccttcagagaattcgacaaggac
aaggatggctacatcaactgccgggatctgggcaactgcatgcgcaccatgggctacatg
cccaccgagatggagctcatcgaactgtcccagcagatcaacatgaacctgggtggccat
gtagattttgatgacttcgtggagctaatggggcctaaactcctggcagagacagcagat
atgattggtgtaaaggaactgcgagatgctttccgagagtttgacaccaatggtgatggg
gaaataagcaccagtgagctgcgagaggctatgaggaagctcctgggtcatcaggtggga
caccgagacatagaggaaattatccgagatgtggacctcaatggggatggacgagtggac
tttgaagagtttgtccggatgatgtcccgctga

DBGET integrated database retrieval system