KEGG   Homo sapiens (human): 948Help
Entry
948               CDS       T01001                                 

Gene name
CD36, BDPLT10, CHDS7, FAT, GP3B, GP4, GPIV, PASIV, SCARB3
Definition
(RefSeq) CD36 molecule
  KO
K06259  CD36 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04145  Phagosome
hsa04152  AMPK signaling pathway
hsa04512  ECM-receptor interaction
hsa04640  Hematopoietic cell lineage
hsa04920  Adipocytokine signaling pathway
hsa04931  Insulin resistance
hsa04975  Fat digestion and absorption
hsa04979  Cholesterol metabolism
hsa05144  Malaria
Disease
H01108  CD36 deficiency
H01742  Coronary artery disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    948 (CD36)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    948 (CD36)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    948 (CD36)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    948 (CD36)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    948 (CD36)
   03320 PPAR signaling pathway
    948 (CD36)
  09154 Digestive system
   04975 Fat digestion and absorption
    948 (CD36)
   04979 Cholesterol metabolism
    948 (CD36)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    948 (CD36)
  09174 Infectious diseases: Parasitic
   05144 Malaria
    948 (CD36)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    948 (CD36)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    948 (CD36)
   04090 CD molecules [BR:hsa04090]
    948 (CD36)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    948 (CD36)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   948 (CD36)
CD molecules [BR:hsa04090]
 Proteins
  948 (CD36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD36
Motif
Other DBs
NCBI-GeneID: 948
NCBI-ProteinID: NP_000063
OMIM: 173510
HGNC: 1663
Ensembl: ENSG00000135218
Vega: OTTHUMG00000155383
Pharos: P16671(Tbio)
UniProt: P16671 A4D1B1
Structure
PDB: 

Position
7q21.11
AA seq 472 aa AA seqDB search
MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTE
VYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGA
IFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLW
GYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWE
SHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAF
ASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGL
NPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETG
TIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtgaccggaactgtgggctcatcgctggggctgtcattggtgctgtcctggct
gtgtttggaggtattctaatgccagttggagacctgcttatccagaagacaattaaaaag
caagttgtcctcgaagaaggtacaattgcttttaaaaattgggttaaaacaggcacagaa
gtttacagacagttttggatctttgatgtgcaaaatccacaggaagtgatgatgaacagc
agcaacattcaagttaagcaaagaggtccttatacgtacagagttcgttttctagccaag
gaaaatgtaacccaggacgctgaggacaacacagtctctttcctgcagcccaatggtgcc
atcttcgaaccttcactatcagttggaacagaggctgacaacttcacagttctcaatctg
gctgtggcagctgcatcccatatctatcaaaatcaatttgttcaaatgatcctcaattca
cttattaacaagtcaaaatcttctatgttccaagtcagaactttgagagaactgttatgg
ggctatagggatccatttttgagtttggttccgtaccctgttactaccacagttggtctg
ttttatccttacaacaatactgcagatggagtttataaagttttcaatggaaaagataac
ataagtaaagttgccataatcgacacatataaaggtaaaaggaatctgtcctattgggaa
agtcactgcgacatgattaatggtacagatgcagcctcatttccaccttttgttgagaaa
agccaggtattgcagttcttttcttctgatatttgcaggtcaatctatgctgtatttgaa
tccgacgttaatctgaaaggaatccctgtgtatagatttgttcttccatccaaggccttt
gcctctccagttgaaaacccagacaactattgtttctgcacagaaaaaattatctcaaaa
aattgtacatcatatggtgtgctagacatcagcaaatgcaaagaagggagacctgtgtac
atttcacttcctcattttctgtatgcaagtcctgatgtttcagaacctattgatggatta
aacccaaatgaagaagaacataggacatacttggatattgaacctataactggattcact
ttacaatttgcaaaacggctgcaggtcaacctattggtcaagccatcagaaaaaattcaa
gtattaaagaatctgaagaggaactatattgtgcctattctttggcttaatgagactggg
accattggtgatgagaaggcaaacatgttcagaagtcaagtaactggaaaaataaacctc
cttggcctgatagaaatgatcttactcagtgttggtgtggtgatgtttgttgcttttatg
atttcatattgtgcatgcagatcgaaaacaataaaataa

DBGET integrated database retrieval system