KEGG   Homo sapiens (human): 9481
Entry
9481              CDS       T01001                                 

Gene name
SLC25A27, UCP4
Definition
(RefSeq) solute carrier family 25 member 27
  KO
K15112  solute carrier family 25 (mitochondrial uncoupling protein), member 27
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    9481 (SLC25A27)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   9481 (SLC25A27)
SSDB
Motif
Pfam: Mito_carr SLC25_like ivWA-helical_N
Other DBs
NCBI-GeneID: 9481
NCBI-ProteinID: NP_004268
OMIM: 613725
HGNC: 21065
Ensembl: ENSG00000153291
Vega: OTTHUMG00000014786
Pharos: O95847(Tbio)
UniProt: O95847
Position
6p12.3
AA seq 323 aa
MSVPEEEERLLPLTQRWPRASKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGD
GARESAPYRGMVRTALGIIEEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKS
EDEHYPLWKSVIGGMMAGVIGQFLANPTDLVKVQMQMEGKRKLEGKPLRFRGVHHAFAKI
LAEGGIRGLWAGWVPNIQRAALVNMGDLTTYDTVKHYLVLNTPLEDNIMTHGLSSLCSGL
VASILGTPADVIKSRIMNQPRDKQGRGLLYKSSTDCLIQAVQGEGFMSLYKGFLPSWLRM
TPWSMVFWLTYEKIREMSGVSPF
NT seq 972 nt   +upstreamnt  +downstreamnt
atgtccgtcccggaggaggaggagaggcttttgccgctgacccagagatggccccgagcg
agcaaattcctactgtccggctgcgcggctaccgtggccgagctagcaacctttcccctg
gatctcacaaaaactcgactccaaatgcaaggagaagcagctcttgctcggttgggagac
ggtgcaagagaatctgccccctataggggaatggtgcgcacagctctagggatcattgaa
gaggaaggctttctaaagctttggcaaggagtgacacccgccatttacagacacgtagtg
tattctggaggtcgaatggtcacatatgaacatctccgagaggttgtgtttggcaaaagt
gaagatgagcattatcccctttggaaatcagtcattggagggatgatggctggtgttatt
ggccagtttttagccaatccaactgacctagtgaaggttcagatgcaaatggaaggaaaa
aggaaactggaaggaaaaccattgcgatttcgtggtgtacatcatgcatttgcaaaaatc
ttagctgaaggaggaatacgagggctttgggcaggctgggtacccaatatacaaagagca
gcactggtgaatatgggagatttaaccacttatgatacagtgaaacactacttggtattg
aatacaccacttgaggacaatatcatgactcacggtttatcaagtttatgttctggactg
gtagcttctattctgggaacaccagccgatgtcatcaaaagcagaataatgaatcaacca
cgagataaacaaggaaggggacttttgtataaatcatcgactgactgcttgattcaggct
gttcaaggtgaaggattcatgagtctatataaaggctttttaccatcttggctgagaatg
accccttggtcaatggtgttctggcttacttatgaaaaaatcagagagatgagtggagtc
agtccattttaa

DBGET integrated database retrieval system