KEGG   Homo sapiens (human): 9493Help
Entry
9493              CDS       T01001                                 

Gene name
KIF23, CHO1, KNSL5, MKLP-1, MKLP1
Definition
(RefSeq) kinesin family member 23
  KO
K17387  kinesin family member 23
Organism
hsa  Homo sapiens (human)
Pathway
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    9493 (KIF23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9493 (KIF23)
   03036 Chromosome and associated proteins [BR:hsa03036]
    9493 (KIF23)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    9493 (KIF23)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    9493 (KIF23)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    9493 (KIF23)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     9493 (KIF23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin MKLP1_Arf_bdg Microtub_bd
Motif
Other DBs
NCBI-GeneID: 9493
NCBI-ProteinID: NP_612565
OMIM: 605064
HGNC: 6392
Ensembl: ENSG00000137807
Vega: OTTHUMG00000172062
Pharos: Q02241(Tbio)
UniProt: Q02241
Structure
PDB: 

Position
15q23
AA seq 960 aa AA seqDB search
MKSARAKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNTTVQLHTPEGY
RLNRNGDYKETQYSFKQVFGTHTTQKELFDVVANPLVNDLIHGKNGLLFTYGVTGSGKTH
TMTGSPGEGGLLPRCLDMIFNSIGSFQAKRYVFKSNDRNSMDIQCEVDALLERQKREAMP
NPKTSSSKRQVDPEFADMITVQEFCKAEEVDEDSVYGVFVSYIEIYNNYIYDLLEEVPFD
PIKPKPPQSKLLREDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLNRESSR
SHSVFNIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTRAEGNRLREAGNI
NQSLMTLRTCMDVLRENQMYGTNKMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKAEDY
EENLQVMRFAEVTQEVEVARPVDKAICGLTPGRRYRNQPRGPVGNEPLVTDVVLQSFPPL
PSCEILDINDEQTLPRLIEALEKRHNLRQMMIDEFNKQSNAFKALLQEFDNAVLSKENHM
QGKLNEKEKMISGQKLEIERLEKKNKTLEYKIEILEKTTTIYEEDKRNLQQELETQNQKL
QRQFSDKRRLEARLQGMVTETTMKWEKECERRVAAKQLEMQNKLWVKDEKLKQLKAIVTE
PKTEKPERPSRERDREKVTQRSVSPSPVPLSSNYIAQISNGQQLMSQPQLHRRSNSCSSI
SVASCISEWEQKIPTYNTPLKVTSIARRRQQEPGQSKTCIVSDRRRGMYWTEGREVVPTF
RNEIEIEEDHCGRLLFQPDQNAPPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHVPH
AITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETLKQ
ESPNGSRKRRSSTVAPAQPDGAESEWTDVETRCSVAVEMRAGSQLGPGYQHHAQPKRKKP
NT seq 2883 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcagcgagagctaagacaccccggaaacctaccgtgaaaaaagggtcccaaacg
aaccttaaagacccagttggggtatactgtagggtgcgcccactgggctttcctgatcaa
gagtgttgcatagaagtgatcaataatacaactgttcagcttcatactcctgagggctac
agactcaaccgaaatggagactataaggagactcagtattcatttaaacaagtatttggc
actcacaccacccagaaggaactctttgatgttgtggctaatcccttggtcaatgacctc
attcatggcaaaaatggtcttctttttacatatggtgtgacgggaagtggaaaaactcac
acaatgactggttctccaggggaaggagggctgcttcctcgttgtttggacatgatcttt
aacagtatagggtcatttcaagctaaacgatatgttttcaaatctaatgataggaatagt
atggatatacagtgtgaggttgatgccttattagaacgtcagaaaagagaagctatgccc
aatccaaagacttcttctagcaaacgacaagtagatccagagtttgcagatatgataact
gtacaagaattctgcaaagcagaagaggttgatgaagatagtgtctatggtgtatttgtc
tcttatattgaaatatataataattacatatatgatctattggaagaggtgccgtttgat
cccataaaacccaaacctccacaatctaaattgcttcgtgaagataagaaccataacatg
tatgttgcaggatgtacagaagttgaagtgaaatctactgaggaggcttttgaagttttc
tggagaggccagaaaaagagacgtattgctaatacccatttgaatcgtgagtccagccgt
tcccatagcgtgttcaacattaaattagttcaggctcccttggatgcagatggagacaat
gtcttacaggaaaaagaacaaatcactataagtcagttgtccttggtagatcttgctgga
agtgaaagaactaaccggaccagagcagaagggaacagattacgtgaagctggtaatatt
aatcagtcactaatgacgctaagaacatgtatggatgtcctaagagagaaccaaatgtat
ggaactaacaagatggttccatatcgagattcaaagttaacccatctgttcaagaactac
tttgatggggaaggaaaagtgcggatgatcgtgtgtgtgaaccccaaggctgaagattat
gaagaaaacttgcaagtcatgagatttgcggaagtgactcaagaagttgaagtagcaaga
cctgtagacaaggcaatatgtggtttaacgcctgggaggagatacagaaaccagcctcga
ggtccagttggaaatgaaccattggttactgacgtggttttgcagagttttccacctttg
ccatcatgcgaaattttggatatcaacgatgagcagacacttccaaggctgattgaagcc
ttagagaaacgacataacttacgacaaatgatgattgatgagtttaacaaacaatctaat
gcttttaaagctttgttacaagaatttgacaatgctgttttaagtaaagaaaaccacatg
caagggaaactaaatgaaaaggagaagatgatctcaggacagaaattggaaatagaacga
ctggaaaagaaaaacaaaactttagaatataagattgagattttagagaaaacaactact
atctatgaggaagataaacgcaatttgcaacaggaacttgaaactcagaaccagaaactt
cagcgacagttttctgacaaacgcagattagaagccaggttgcaaggcatggtgacagaa
acgacaatgaagtgggagaaagaatgtgagcgtagagtggcagccaaacagctggagatg
cagaataaactctgggttaaagatgaaaagctgaaacaactgaaggctattgttaccgaa
cctaaaactgagaagccagagagaccctctcgggagcgagatcgagaaaaagttactcaa
agatctgtttctccatcacctgtgcctctttctagtaactatattgctcagatttccaac
ggccagcaactcatgagccagccacagctacataggcgctctaactcttgcagcagcatt
tctgtagcttcctgtatttcggaatgggagcagaaaattcctacgtacaacacacctctc
aaagtcacatctattgcaaggcgtaggcagcaggagccaggacaaagcaaaacttgtatc
gtgtcagacagaaggcgagggatgtactggactgaaggcagggaggtggttcctacattc
agaaatgagatagaaatagaagaggatcattgcggcaggttactctttcaacctgatcag
aacgcaccaccaattcgtctccgacacagacgatcacgctctgcaggagacagatgggta
gatcataagcccgcctctaacatgcaaactgaaacagtcatgcagccacatgtccctcat
gccatcacagtatctgttgcaaatgaaaaggcactagctaagtgtgagaagtacatgctg
acccaccaggaactagcctccgatggggagattgaaactaaactaattaagggtgatatt
tataaaacaaggggtggtggacaatctgttcagtttactgatattgagactttaaagcaa
gaatcaccaaatggtagtcgaaaacgaagatcttccacagtagcacctgcccaaccagat
ggtgcagagtctgaatggaccgatgtagaaacaaggtgttctgtggctgtggagatgaga
gcaggatcccagctgggacctggatatcagcatcacgcacaacccaagcgcaaaaagcca
tga

DBGET integrated database retrieval system