KEGG   Homo sapiens (human): 9497
Entry
9497              CDS       T01001                                 

Gene name
SLC4A7, NBC2, NBC3, NBCN1, SBC2, SLC4A6
Definition
(RefSeq) solute carrier family 4 member 7
  KO
K13858  solute carrier family 4 (sodium bicarbonate cotransporter), member 7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    9497 (SLC4A7)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    9497 (SLC4A7)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   USH complex and associated proteins
    9497 (SLC4A7)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   9497 (SLC4A7)
SSDB
Motif
Pfam: HCO3_cotransp Band_3_cyto DUF4922
Other DBs
NCBI-GeneID: 9497
NCBI-ProteinID: NP_003606
OMIM: 603353
HGNC: 11033
Ensembl: ENSG00000033867
Vega: OTTHUMG00000155679
Pharos: Q9Y6M7(Tbio)
UniProt: Q9Y6M7
Position
3p24.1
AA seq 1214 aa
MERFRLEKKLPGPDEEAVVDLGKTSSTVNTKFEKEELESHRAVYIGVHVPFSKESRRRHR
HRGHKHHHRRRKDKESDKEDGRESPSYDTPSQRVQFILGTEDDDEEHIPHDLFTEMDELC
YRDGEEYEWKETARWLKFEEDVEDGGDRWSKPYVATLSLHSLFELRSCILNGTVMLDMRA
STLDEIADMVLDNMIASGQLDESIRENVREALLKRHHHQNEKRFTSRIPLVRSFADIGKK
HSDPHLLERNGEGLSASRHSLRTGLSASNLSLRGESPLSLLLGHLLPSSRAGTPAGSRCT
TPVPTPQNSPPSSPSISRLTSRSSQESQRQAPELLVSPASDDIPTVVIHPPEEDLEAALK
GEEQKNEENVDLTPGILASPQSAPGNLDNSKSGEIKGNGSGGSRENSTVDFSKVDMNFMR
KIPTGAEASNVLVGEVDFLERPIIAFVRLAPAVLLTGLTEVPVPTRFLFLLLGPAGKAPQ
YHEIGRSIATLMTDEIFHDVAYKAKDRNDLLSGIDEFLDQVTVLPPGEWDPSIRIEPPKS
VPSQEKRKIPVFHNGSTPTLGETPKEAAHHAGPELQRTGRLFGGLILDIKRKAPFFLSDF
KDALSLQCLASILFLYCACMSPVITFGGLLGEATEGRISAIESLFGASLTGIAYSLFAGQ
PLTILGSTGPVLVFEKILYKFCRDYQLSYLSLRTSIGLWTSFLCIVLVATDASSLVCYIT
RFTEEAFAALICIIFIYEALEKLFDLGETYAFNMHNNLDKLTSYSCVCTEPPNPSNETLA
QWKKDNITAHNISWRNLTVSECKKLRGVFLGSACGHHGPYIPDVLFWCVILFFTTFFLSS
FLKQFKTKRYFPTKVRSTISDFAVFLTIVIMVTIDYLVGVPSPKLHVPEKFEPTHPERGW
IISPLGDNPWWTLLIAAIPALLCTILIFMDQQITAVIINRKEHKLKKGAGYHLDLLMVGV
MLGVCSVMGLPWFVAATVLSISHVNSLKVESECSAPGEQPKFLGIREQRVTGLMIFILMG
LSVFMTSVLKFIPMPVLYGVFLYMGVSSLKGIQLFDRIKLFGMPAKHQPDLIYLRYVPLW
KVHIFTVIQLTCLVLLWVIKVSAAAVVFPMMVLALVFVRKLMDLCFTKRELSWLDDLMPE
SKKKKEDDKKKKEKEEAERMLQDDDDTVHLPFEGGSLLQIPVKALKYSPDKPVSVKISFE
DEPRKKYVDAETSL
NT seq 3645 nt   +upstreamnt  +downstreamnt
atggaaagatttcgtctggagaagaagttacctggtcctgatgaagaagctgttgtggat
cttggcaaaactagctcaactgtgaacaccaagtttgaaaaagaagaactagaaagtcat
agagctgtatatattggtgttcacgtcccgtttagtaaagagagtcgtcggcgtcatagg
catcgcggacacaaacatcaccaccggagaagaaaagataaagaatcagataaagaagat
ggacgggaatctccttcttatgatacaccatcccagagagttcagtttatccttggtact
gaagatgatgatgaagaacatattccccatgatctcttcacggaaatggatgaactgtgt
tacagagatggagaagaatatgaatggaaagaaactgctagatggctgaaatttgaagag
gatgttgaagatggcggtgaccgatggagtaaaccttatgtggcaactctctctttgcac
agtctttttgaactaaggagttgcatcctcaatggaacagtcatgctggatatgagagca
agcactctagatgaaatagcagatatggtattagacaacatgatagcttctggccaatta
gacgagtccatacgagagaatgtcagagaagctcttctgaagagacatcatcatcagaat
gagaaaagattcaccagtcggattcctcttgttcgatcttttgcagatataggcaagaaa
cattctgaccctcacttgcttgaaaggaatggggaaggcctttcagcctcccgccactct
ttgcgaacaggtctgtctgcctcaaacctttccttgagaggagaatcacctttatctctt
cttcttggtcatcttcttccttcttcaagagctggaacccctgcaggctcaaggtgtaca
accccagtacccacccctcaaaacagtcctccttctagccctagcatcagccgcctgacc
tccagaagttcccaagagagtcagcgtcaggccccagaactactggtttcacctgccagt
gatgatattcccacagtagtaattcatccgcctgaggaagacttagaagcagcgctgaaa
ggcgaggagcagaagaatgaggaaaatgttgacttaactccaggtattttggcctctccc
cagtctgctcctggaaacttggacaatagtaaaagtggagaaattaaaggtaatggaagt
ggtggaagcagagaaaatagtactgttgacttcagcaaggttgatatgaatttcatgaga
aaaattcctacgggtgctgaggcatccaacgtcctggtgggcgaagtagactttttggaa
aggccaataattgcatttgtgagactggctcctgctgtcctccttacagggttgactgag
gtccctgttccaaccaggtttttgtttttgttattgggtccagcgggcaaggcaccacag
taccatgaaattggacgatcaatagccactctcatgacagatgagattttccatgatgta
gcttataaagcaaaagacagaaatgacctcttatctggaattgatgaatttttagatcaa
gtaactgtcctacctccaggagagtgggatccttctatacgcatagaaccaccaaaaagt
gtcccttctcaggaaaagagaaagattcctgtgtttcacaatggatctacccccacactg
ggtgagactcctaaagaggccgctcatcatgctgggcctgagctacagaggactggacgg
ctttttggtggtttgatacttgacatcaaaaggaaagcaccttttttcttgagtgacttc
aaggatgcattaagcctgcagtgcctggcctcgattcttttcctatactgtgcctgtatg
tctcctgtaatcacttttggagggctgcttggagaagctacagaaggcagaataagtgca
atagagtctctttttggagcatcattaactgggattgcctattcattgtttgctgggcaa
cctctaacaatattggggagcacaggtccagttctagtgtttgaaaaaattttatataaa
ttctgcagagattatcaactttcttatctgtctttaagaaccagtattggtctgtggact
tcttttttgtgcattgttttggttgcaacagatgcaagcagccttgtgtgttatattact
cgatttacagaagaggcttttgcagcccttatttgcatcatattcatctacgaggctttg
gagaagctctttgatttaggagaaacatatgcatttaatatgcacaacaacttagataaa
ctgaccagctactcatgtgtatgtactgaacctccaaaccccagcaatgaaactctagca
caatggaagaaagataatataacagcacacaatatttcctggagaaatcttactgtttct
gaatgtaaaaaacttcgtggtgtattcttggggtcagcttgtggtcatcatggaccttat
attccagatgtgctcttttggtgtgtcatcttgtttttcacaacattttttctgtcttca
ttcctcaagcaatttaagaccaagcgttactttcctaccaaggtgcgatcgacaatcagt
gattttgctgtatttctcacaatagtaataatggttacaattgactaccttgtaggagtt
ccatctcctaaacttcatgttcctgaaaaatttgagcctactcatccagagagagggtgg
atcataagcccactgggagataatccttggtggaccttattaatagctgctattcctgct
ttgctttgtaccattctcatctttatggatcaacaaatcacagctgtaattataaacaga
aaggaacacaaattgaagaaaggagctggctatcaccttgatttgctcatggttggcgtt
atgttgggagtttgctctgtcatgggacttccatggtttgtggctgcaacagtgttgtca
ataagtcatgtcaacagcttaaaagttgaatctgaatgttctgctccaggggaacaaccc
aagtttttgggaattcgtgaacagcgggttacagggctaatgatttttattctaatgggc
ctctctgtgttcatgacttcagtcctaaagtttattccaatgcctgttctgtatggtgtt
ttcctttatatgggagtttcctcattaaaaggaatccagttatttgaccgtataaaatta
tttggaatgcctgctaagcatcagcctgatttgatatacctccgttatgtgccgctctgg
aaggtccatattttcacagtcattcagcttacttgtttggtccttttatgggtgataaaa
gtttcagctgctgcagtggtttttcccatgatggttcttgcattagtgtttgtgcgcaaa
ctcatggacctgtgtttcacgaagagagaacttagttggcttgatgatcttatgccagaa
agtaagaaaaagaaagaagatgacaaaaagaaaaaagagaaagaggaagctgaacggatg
cttcaagatgatgatgatactgtgcaccttccatttgaagggggaagtctcttgcaaatt
ccagtcaaggccctaaaatatagtcctgataaacctgtgagtgtgaaaataagttttgaa
gatgaaccaagaaagaaatacgtggatgctgaaacttcattatag

DBGET integrated database retrieval system