KEGG   Homo sapiens (human): 9498Help
Entry
9498              CDS       T01001                                 

Gene name
SLC4A8, NBC3, NDCBE
Definition
(RefSeq) solute carrier family 4 member 8
  KO
K13859  solute carrier family 4 (sodium bicarbonate cotransporter), member 8
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    9498 (SLC4A8)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   9498 (SLC4A8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto Mu-transpos_C
Motif
Other DBs
NCBI-GeneID: 9498
NCBI-ProteinID: NP_001035049
OMIM: 605024
HGNC: 11034
Ensembl: ENSG00000050438
Vega: OTTHUMG00000169489
Pharos: Q2Y0W8(Tbio)
UniProt: Q2Y0W8
Structure
PDB: 

Position
12q13.13
AA seq 1093 aa AA seqDB search
MPAAGSNEPDGVLSYQRPDEEAVVDQGGTSTILNIHYEKEELEGHRTLYVGVRMPLGRQS
HRHHRTHGQKHRRRGRGKGASQGEEGLEALAHDTPSQRVQFILGTEEDEEHVPHELFTEL
DEICMKEGEDAEWKETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCLINGTVLL
DMHANSIEEISDLILDQQELSSDLNDSMRVKVREALLKKHHHQNEKKRNNLIPIVRSFAE
VGKKQSDPHLMDKHGQTVSPQSVPTTNLEVKNGVNCEHSPVDLSKVDLHFMKKIPTGAEA
SNVLVGEVDILDRPIVAFVRLSPAVLLSGLTEVPIPTRFLFILLGPVGKGQQYHEIGRSM
ATIMTDEIFHDVAYKAKERDDLLAGIDEFLDQVTVLPPGEWDPSIRIEPPKNVPSQEKRK
MPGVPNGNVCHIEQEPHGGHSGPELQRTGRLFGGLVLDIKRKAPWYWSDYRDALSLQCLA
SFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFAGQALTILGSTGP
VLVFEKILFKFCKDYALSYLSLRACIGLWTAFLCIVLVATDASSLVCYITRFTEEAFASL
ICIIFIYEAIEKLIHLAETYPIHMHSQLDHLSLYYCRCTLPENPNNHTLQYWKDHNIVTA
EVHWANLTVSECQEMHGEFMGSACGHHGPYTPDVLFWSCILFFTTFILSSTLKTFKTSRY
FPTRVRSMVSDFAVFLTIFTMVIIDFLIGVPSPKLQVPSVFKPTRDDRGWIINPIGPNPW
WTVIAAIIPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLLMVAIMLGVCSIMGL
PWFVAATVLSITHVNSLKLESECSAPGEQPKFLGIREQRVTGLMIFVLMGCSVFMTAILK
FIPMPVLYGVFLYMGVSSLQGIQFFDRLKLFGMPAKHQPDFIYLRHVPLRKVHLFTLIQL
TCLVLLWVIKASPAAIVFPMMVLALVFVRKVMDLCFSKRELSWLDDLMPESKKKKLDDAK
KKAKEEEEAEKMLEIGGDKFPLESRKLLSSPGKNISCRCDPSEINISDEMPKTTVWKALS
MNSGNAKEKSLFN
NT seq 3282 nt NT seq  +upstreamnt  +downstreamnt
atgccggccgccgggagtaacgagccggacggcgtcctcagctatcagagaccagatgaa
gaagctgtggtggatcagggtgggaccagtacaattctcaacattcactatgaaaaagaa
gagctggaaggtcacagaactctgtatgtgggagttcggatgccgcttggccggcagagc
catcggcatcaccgcactcatggccagaagcaccggagacgagggcggggcaaaggagcc
agccagggggaggaaggcctggaagccctggcccacgacacaccatctcagcgtgttcag
ttcattcttggcaccgaggaagatgaagagcatgtgcctcatgagctgtttacagagctg
gatgagatctgtatgaaagagggagaagatgctgagtggaaggaaacagccaggtggctg
aagtttgaagaagatgttgaagatgggggagaacgctggagcaagccttatgtggcaacc
ctttcattgcacagcctgtttgagctaaggagctgccttattaatggaacagtcctcctg
gatatgcatgcaaatagcatagaagaaatttcagacctgatcctggatcagcaagaactg
tccagtgacctgaatgacagcatgagggttaaagtgcgggaagcccttctcaaaaagcat
catcatcagaatgaaaagaagagaaacaacctcattcccattgttcgctcctttgctgag
gttggcaagaagcagtctgatcctcatttgatggataaacatggtcaaaccgtgtctcct
cagtctgttccaactacaaatcttgaagtaaaaaatggagtgaattgtgaacatagtcct
gtggatttaagcaaggtagaccttcatttcatgaaaaaaattcctactggggccgaggcc
tccaatgtcctggttggagaggtggatattttggaccgtcccattgttgcctttgtgagg
ctgtctccagctgttcttctctcaggcctaacagaagtgccaatcccaacaagatttttg
tttatcttattgggtccagtagggaaaggtcagcagtaccatgagattggcagatccatg
gccaccatcatgacagatgagatttttcatgacgtagcatataaggcaaaagagcgagat
gatctcctggcggggattgatgagttcctagaccaggtgacggtgctccctccaggagag
tgggatccctccattagaattgagccacccaaaaatgtcccttcccaggagaaaaggaaa
atgcctggagttccaaatggaaatgtttgccacatagaacaggaaccacatgggggtcac
agtgggccagaacttcagcgcactgggcggctatttgggggcttggtgctggacatcaag
cggaaggccccctggtactggagcgactaccgagatgcactcagcttacagtgtttggct
tcctttctgttcctgtactgtgcctgcatgtcacctgtcatcacctttgggggactgctt
ggagaagccactgagggacgcataagtgcaattgaatccttgtttggagcttccatgact
gggattgcttattccttgtttgcgggacaggctctcaccatcctgggaagtactggacca
gtgcttgtgtttgaaaagattttgttcaaattctgcaaagactatgctctttcatacctc
tccctgcgagcttgtattggactgtggaccgctttcctgtgtattgtccttgtggcaact
gatgccagttcccttgtctgctacattacccgtttcactgaagaagcatttgcctcccta
atttgcattattttcatctatgaagcaatagaaaaactgattcacctggcagagacctac
cccatccacatgcacagccagctggaccaccttagcctctattactgcaggtgtactctg
ccagagaatccaaacaatcacaccctccagtactggaaggaccacaacatcgtgacagca
gaagtccactgggctaacctgactgtcagtgaatgccaggagatgcatggagagttcatg
ggatctgcgtgcggccatcatggaccctacactcctgatgtcctcttttggtcctgtatt
ctctttttcaccaccttcatcctctcaagcaccttaaagacgtttaagacgagccgttat
ttcccaaccagagtacgctccatggtgagtgactttgctgttttcctcactatcttcaca
atggtgattattgattttttgattggagtcccatcaccaaagcttcaagttcccagtgtg
ttcaagccaacaagggatgatcgcggatggattattaatcccattggccccaatccctgg
tggactgtgatagctgcaattatcccagctcttctctgtactatcttgatattcatggat
cagcagatcacagccgtcattattaacaggaaggaacataagctcaagaaaggctgtggc
taccacctggacctactgatggtggccatcatgctgggtgtctgctccatcatgggcctg
ccctggtttgtagctgcaactgtcttgtccatcacacatgtgaacagcctcaagctagaa
tctgaatgctctgctcctggagaacagcccaagttcctgggcatccgagaacagagagtg
acaggccttatgatctttgtgctgatgggctgctcagtcttcatgacggctatcttaaag
tttattccaatgccagtactctacggagttttcctttacatgggagtttcttcactacag
ggaattcagttctttgatcgtctaaagctctttgggatgcccgcaaagcaccagccagat
ttcatctacctgcggcatgtgccgctgcgcaaagtgcacctcttcaccctcatccagttg
acctgtctcgtcctgctctgggtcatcaaggcatctccagctgccattgttttcccaatg
atggttttggccttggtctttgtcaggaaagtcatggatctctgtttctctaagcgagag
ctgagctggctagatgatctcatgcctgaaagcaaaaagaagaagttggatgatgccaaa
aagaaggccaaggaggaagaggaggctgagaaaatgttagaaattgggggagacaagttt
cccttagagagcaggaagttactaagtagtcctggaaagaacatcagttgcagatgtgac
ccctctgagattaatatatctgatgaaatgcctaaaactacagtttggaaagctctcagt
atgaattctggaaatgcaaaggaaaagagtctcttcaactaa

DBGET integrated database retrieval system