KEGG   Homo sapiens (human): 950Help
Entry
950               CDS       T01001                                 

Gene name
SCARB2, AMRF, CD36L2, EPM4, HLGP85, LGP85, LIMP-2, LIMPII, SR-BII
Definition
(RefSeq) scavenger receptor class B member 2
  KO
K12384  lysosome membrane protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
Disease
H00810  Progressive myoclonic epilepsy (PME/ EPM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    950 (SCARB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD36
Motif
Other DBs
NCBI-GeneID: 950
NCBI-ProteinID: NP_005497
OMIM: 602257
HGNC: 1665
Ensembl: ENSG00000138760
Vega: OTTHUMG00000130099
Pharos: Q14108(Tbio)
UniProt: Q14108 A0A024RDG6
Structure
PDB: 

Position
4q21.1
AA seq 478 aa AA seqDB search
MGRCCFYTAGTLSLLLLVTSVTLLVARVFQKAVDQSIEKKIVLRNGTEAFDSWEKPPLPV
YTQFYFFNVTNPEEILRGETPRVEEVGPYTYRELRNKANIQFGDNGTTISAVSNKAYVFE
RDQSVGDPKIDLIRTLNIPVLTVIEWSQVHFLREIIEAMLKAYQQKLFVTHTVDELLWGY
KDEILSLIHVFRPDISPYFGLFYEKNGTNDGDYVFLTGEDSYLNFTKIVEWNGKTSLDWW
ITDKCNMINGTDGDSFHPLITKDEVLYVFPSDFCRSVYITFSDYESVQGLPAFRYKVPAE
ILANTSDNAGFCIPEGNCLGSGVLNVSICKNGAPIIMSFPHFYQADERFVSAIEGMHPNQ
EDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKE
TASRLKSMINTTLIITNIPYIIMALGVFFGLVFTWLACKGQGSMDEGTADERAPLIRT
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgggccgatgctgcttctacacggcggggacgttgtccctgctcctgctggtgaccagc
gtcacgctgctggtggcccgggtcttccagaaggctgtagaccagagtatcgagaagaaa
attgtgttaaggaatggtactgaggcatttgactcctgggagaagccccctctgcctgtg
tatactcagttctatttcttcaatgtcaccaatccagaggagatcctcagaggggagacc
cctcgggtggaagaagtggggccatacacctacagggaactcagaaacaaagcaaatatt
caatttggagataatggaacaacaatatctgctgttagcaacaaggcctatgtttttgaa
cgagaccaatctgttggagaccctaaaattgacttaattagaacattaaatattcctgta
ttgactgtcatagagtggtcccaggtgcacttcctcagggagatcatcgaggccatgttg
aaagcctatcagcagaagctctttgtgactcacacagttgacgaattgctctggggctac
aaagatgaaatcttgtcccttatccatgttttcaggcccgatatctctccctattttggc
ctattctatgagaaaaatgggactaatgatggagactatgtttttctaactggagaagac
agttaccttaactttacaaaaattgtggaatggaatgggaaaacgtcacttgactggtgg
ataacagacaagtgcaatatgattaatggaacagatggagattcttttcacccactaata
accaaagatgaggtcctttatgtcttcccatctgacttttgcaggtcagtgtatattact
ttcagtgactatgagagtgtacagggactgcctgcctttcggtataaagttcctgcagaa
atattagccaatacgtcagacaatgccggcttctgtatacctgagggaaactgcctgggc
tcaggagttctgaatgtcagcatctgcaagaatggtgcacccatcattatgtctttccca
cacttttaccaagcagatgagaggtttgtttctgccatagaaggcatgcacccaaatcag
gaagaccatgagacatttgtggacattaatcctttgactggaataatcctaaaagcagcc
aagaggttccaaatcaacatttatgtcaaaaaattagatgactttgttgaaacgggagac
attagaaccatggttttcccagtgatgtacctcaatgagagtgttcacattgataaagag
acggcgagtcgactgaagtctatgattaacactactttgatcatcaccaacataccctac
atcatcatggcgctgggtgtgttctttggtttggtttttacctggcttgcatgcaaagga
cagggatccatggatgagggaacagcggatgaaagagcacccctcattcgaacctaa

DBGET integrated database retrieval system