KEGG   Homo sapiens (human): 9506
Entry
9506              CDS       T01001                                 
Symbol
PAGE4, CT16.7, GAGE-9, GAGEC1, JM-27, JM27, PAGE-1, PAGE-4
Name
(RefSeq) PAGE family member 4
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: GAGE
Other DBs
NCBI-GeneID: 9506
NCBI-ProteinID: NP_001305806
OMIM: 300287
HGNC: 4108
Ensembl: ENSG00000101951
Pharos: O60829(Tbio)
UniProt: O60829
Structure
Position
X:49829260..49834264
AA seq 102 aa
MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVE
GDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP
NT seq 309 nt   +upstreamnt  +downstreamnt
atgagtgcacgagtgagatcaagatccagaggaagaggagatggtcaggaggctcccgat
gtggttgcattcgtggctcccggtgaatctcagcaagaggaaccaccaactgacaatcag
gatattgaacctggacaagagagagaaggaacacctccgatcgaagaacgtaaagtagaa
ggtgattgccaggaaatggatctggaaaagactcggagtgagcgtggagatggctctgat
gtaaaagagaagactccacctaatcctaagcatgctaagactaaagaagcaggagatggg
cagccataa

DBGET integrated database retrieval system