KEGG   Homo sapiens (human): 9507Help
Entry
9507              CDS       T01001                                 

Gene name
ADAMTS4, ADAMTS-2, ADAMTS-4, ADMP-1
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 4
  KO
K07764  a disintegrin and metalloproteinase with thrombospondin motifs 4 [EC:3.4.24.82]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    9507 (ADAMTS4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.82  ADAMTS-4 endopeptidase
     9507 (ADAMTS4)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   9507 (ADAMTS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADAM_spacer1 ADAM_CR_2 Reprolysin Reprolysin_5 TSP_1 Reprolysin_3 Pep_M12B_propep Reprolysin_2 Reprolysin_4
Motif
Other DBs
NCBI-GeneID: 9507
NCBI-ProteinID: NP_005090
OMIM: 603876
HGNC: 220
Ensembl: ENSG00000158859
Vega: OTTHUMG00000034349
Pharos: O75173(Tchem)
UniProt: O75173
Structure
PDB: 

Position
1q23.3
AA seq 837 aa AA seqDB search
MSQTGSHPGRGLAGRWLWGAQPCLLLPIVPLSWLVWLLLLLLASLLPSARLASPLPREEE
IVFPEKLNGSVLPGSGAPARLLCRLQAFGETLLLELEQDSGVQVEGLTVQYLGQAPELLG
GAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHI
LRRKSPASGQGPMCNVKAPLGSPSPRPRRAKRFASLSRFVETLVVADDKMAAFHGAGLKR
YLLTVMAAAAKAFKHPSIRNPVSLVVTRLVILGSGEEGPQVGPSAAQTLRSFCAWQRGLN
TPEDSDPDHFDTAILFTRQDLCGVSTCDTLGMADVGTVCDPARSCAIVEDDGLQSAFTAA
HELGHVFNMLHDNSKPCISLNGPLSTSRHVMAPVMAHVDPEEPWSPCSARFITDFLDNGY
GHCLLDKPEAPLHLPVTFPGKDYDADRQCQLTFGPDSRHCPQLPPPCAALWCSGHLNGHA
MCQTKHSPWADGTPCGPAQACMGGRCLHMDQLQDFNIPQAGGWGPWGPWGDCSRTCGGGV
QFSSRDCTRPVPRNGGKYCEGRRTRFRSCNTEDCPTGSALTFREEQCAAYNHRTDLFKSF
PGPMDWVPRYTGVAPQDQCKLTCQAQALGYYYVLEPRVVDGTPCSPDSSSVCVQGRCIHA
GCDRIIGSKKKFDKCMVCGGDGSGCSKQSGSFRKFRYGYNNVVTIPAGATHILVRQQGNP
GHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQP
LTLQVLVAGNPQDTRLRYSFFVPRPTPSTPRPTPQDWLHRRAQILEILRRRPWAGRK
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagacaggctcgcatcccgggaggggcttggcagggcgctggctgtggggagcc
caaccctgcctcctgctccccattgtgccgctctcctggctggtgtggctgcttctgcta
ctgctggcctctctcctgccctcagcccggctggccagccccctcccccgggaggaggag
atcgtgtttccagagaagctcaacggcagcgtcctgcctggctcgggcgcccctgccagg
ctgttgtgccgcttgcaggcctttggggagacgctgctactagagctggagcaggactcc
ggtgtgcaggtcgaggggctgacagtgcagtacctgggccaggcgcctgagctgctgggt
ggagcagagcctggcacctacctgactggcaccatcaatggagatccggagtcggtggca
tctctgcactgggatgggggagccctgttaggcgtgttacaatatcggggggctgaactc
cacctccagcccctggagggaggcacccctaactctgctgggggacctggggctcacatc
ctacgccggaagagtcctgccagcggtcaaggtcccatgtgcaacgtcaaggctcctctt
ggaagccccagccccagaccccgaagagccaagcgctttgcttcactgagtagatttgtg
gagacactggtggtggcagatgacaagatggccgcattccacggtgcggggctaaagcgc
tacctgctaacagtgatggcagcagcagccaaggccttcaagcacccaagcatccgcaat
cctgtcagcttggtggtgactcggctagtgatcctggggtcaggcgaggaggggccccaa
gtggggcccagtgctgcccagaccctgcgcagcttctgtgcctggcagcggggcctcaac
acccctgaggactcggaccctgaccactttgacacagccattctgtttacccgtcaggac
ctgtgtggagtctccacttgcgacacgctgggtatggctgatgtgggcaccgtctgtgac
ccggctcggagctgtgccattgtggaggatgatgggctccagtcagccttcactgctgct
catgaactgggtcatgtcttcaacatgctccatgacaactccaagccatgcatcagtttg
aatgggcctttgagcacctctcgccatgtcatggcccctgtgatggctcatgtggatcct
gaggagccctggtccccctgcagtgcccgcttcatcactgacttcctggacaatggctat
gggcactgtctcttagacaaaccagaggctccattgcatctgcctgtgactttccctggc
aaggactatgatgctgaccgccagtgccagctgaccttcgggcccgactcacgccattgt
ccacagctgccgccgccctgtgctgccctctggtgctctggccacctcaatggccatgcc
atgtgccagaccaaacactcgccctgggccgatggcacaccctgcgggcccgcacaggcc
tgcatgggtggtcgctgcctccacatggaccagctccaggacttcaatattccacaggct
ggtggctggggtccttggggaccatggggtgactgctctcggacctgtgggggtggtgtc
cagttctcctcccgagactgcacgaggcctgtcccccggaatggtggcaagtactgtgag
ggccgccgtacccgcttccgctcctgcaacactgaggactgcccaactggctcagccctg
accttccgcgaggagcagtgtgctgcctacaaccaccgcaccgacctcttcaagagcttc
ccagggcccatggactgggttcctcgctacacaggcgtggccccccaggaccagtgcaaa
ctcacctgccaggcccaggcactgggctactactatgtgctggagccacgggtggtagat
gggaccccctgttccccggacagctcctcggtctgtgtccagggccgatgcatccatgct
ggctgtgatcgcatcattggctccaagaagaagtttgacaagtgcatggtgtgcggaggg
gacggttctggttgcagcaagcagtcaggctccttcaggaaattcaggtacggatacaac
aatgtggtcactatccccgcgggggccacccacattcttgtccggcagcagggaaaccct
ggccaccggagcatctacttggccctgaagctgccagatggctcctatgccctcaatggt
gaatacacgctgatgccctcccccacagatgtggtactgcctggggcagtcagcttgcgc
tacagcggggccactgcagcctcagagacactgtcaggccatgggccactggcccagcct
ttgacactgcaagtcctagtggctggcaacccccaggacacacgcctccgatacagcttc
ttcgtgccccggccgaccccttcaacgccacgccccactccccaggactggctgcaccga
agagcacagattctggagatccttcggcggcgcccctgggcgggcaggaaataa

DBGET integrated database retrieval system