KEGG   Homo sapiens (human): 9508
Entry
9508              CDS       T01001                                 
Symbol
ADAMTS3, ADAMTS-4, HKLLS3
Name
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 3
  KO
K08619  a disintegrin and metalloproteinase with thrombospondin motifs 3 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Disease
H02169  Hennekam lymphangiectasia-lymphedema syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    9508 (ADAMTS3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-
     9508 (ADAMTS3)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   9508 (ADAMTS3)
SSDB
Motif
Pfam: Pep_M12B_propep TSP1_ADAMTS ADAMTS_spacer1 TSP_1 Reprolysin ADAMTS_CR_2 Reprolysin_5 Reprolysin_3 Reprolysin_2 TSP1_spondin ADAMTS_CR_3 Reprolysin_4 TSP1_CCN PLAC Peptidase_M10 DUF4953
Other DBs
NCBI-GeneID: 9508
NCBI-ProteinID: NP_055058
OMIM: 605011
HGNC: 219
Ensembl: ENSG00000156140
Pharos: O15072(Tbio)
UniProt: O15072 Q96AY5 B7Z2U9
Position
4:complement(72280969..72569221)
AA seq 1205 aa
MVLLSLWLIAAALVEVRTSADGQAGNEEMVQIDLPIKRYREYELVTPVSTNLEGRYLSHT
LSASHKKRSARDVSSNPEQLFFNITAFGKDFHLRLKPNTQLVAPGAVVEWHETSLVPGNI
TDPINNHQPGSATYRIRRTEPLQTNCAYVGDIVDIPGTSVAISNCDGLAGMIKSDNEEYF
IEPLERGKQMEEEKGRIHVVYKRSAVEQAPIDMSKDFHYRESDLEGLDDLGTVYGNIHQQ
LNETMRRRRHAGENDYNIEVLLGVDDSVVRFHGKEHVQNYLLTLMNIVNEIYHDESLGVH
INVVLVRMIMLGYAKSISLIERGNPSRSLENVCRWASQQQRSDLNHSEHHDHAIFLTRQD
FGPAGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCGDETA
MGSVMAPLVQAAFHRYHWSRCSGQELKRYIHSYDCLLDDPFDHDWPKLPELPGINYSMDE
QCRFDFGVGYKMCTAFRTFDPCKQLWCSHPDNPYFCKTKKGPPLDGTECAAGKWCYKGHC
MWKNANQQKQDGNWGSWTKFGSCSRTCGTGVRFRTRQCNNPMPINGGQDCPGVNFEYQLC
NTEECQKHFEDFRAQQCQQRNSHFEYQNTKHHWLPYEHPDPKKRCHLYCQSKETGDVAYM
KQLVHDGTHCSYKDPYSICVRGECVKVGCDKEIGSNKVEDKCGVCGGDNSHCRTVKGTFT
RTPRKLGYLKMFDIPPGARHVLIQEDEASPHILAIKNQATGHYILNGKGEEAKSRTFIDL
GVEWDYNIEDDIESLHTDGPLHDPVIVLIIPQENDTRSSLTYKYIIHEDSVPTINSNNVI
QEELDTFEWALKSWSQCSKPCGGGFQYTKYGCRRKSDNKMVHRSFCEANKKPKPIRRMCN
IQECTHPLWVAEEWEHCTKTCGSSGYQLRTVRCLQPLLDGTNRSVHSKYCMGDRPESRRP
CNRVPCPAQWKTGPWSECSVTCGEGTEVRQVLCRAGDHCDGEKPESVRACQLPPCNDEPC
LGDKSIFCQMEVLARYCSIPGYNKLCCESCSKRSSTLPPPYLLEAAETHDDVISNPSDLP
RSLVMPTSLVPYHSETPAKKMSLSSISSVGGPNAYAAFRPNSKPDGANLRQRSAQQAGSK
TVRLVTVPSSPPTKRVHLSSASQMAAASFFAASDSIGASSQARTSKKDGKIIDNRRPTRS
STLER
NT seq 3618 nt   +upstreamnt  +downstreamnt
atggttctcctgtcactttggttgatagcagccgctctggtagaggttaggacttcagct
gatggacaagctggtaatgaagaaatggtgcaaatagatttaccaataaagagatataga
gagtatgagctggtgactccagtcagcacaaatctagaaggacgctatctctcccatact
ctttctgcgagtcacaaaaagaggtcagcgagggacgtgtcttccaaccctgagcagttg
ttctttaacatcacggcatttggaaaagattttcatctgcgactaaagcccaacactcaa
ctagtagctcctggggctgttgtggagtggcatgagacatctctggtgcctgggaatata
accgatcccattaacaaccatcaaccaggaagtgctacgtatagaatccggagaacagag
cctttgcagactaactgtgcttatgttggtgacatcgtggacattccaggaacctctgtt
gccatcagcaactgtgatggtctggctggaatgataaaaagtgataatgaagagtatttc
attgaacccttggaaagaggtaaacagatggaggaagaaaaaggaaggattcatgttgtc
tacaagagatcagctgtagaacaggctcccatagacatgtccaaagacttccactacaga
gagtcggacctggaaggccttgatgatctaggtactgtttatggcaacatccaccagcag
ctgaatgaaacaatgagacgccgcagacacgcgggagaaaacgattacaatatcgaggta
ctgctgggagtggatgactctgtggtccgtttccatggcaaagagcacgtccaaaactac
ctcctgaccctaatgaacattgtgaatgaaatttaccatgatgagtccctcggagtgcat
ataaatgtggtcctggtgcgcatgataatgctgggatatgcaaagtccatcagcctcata
gaaaggggaaacccatccagaagcttggagaatgtgtgtcgctgggcgtcccaacagcaa
agatctgatctcaaccactctgaacaccatgaccatgcaatttttttaaccaggcaagac
tttggacctgctggaatgcaaggatatgctccagtcaccggcatgtgtcatccagtgaga
agttgtaccctgaatcatgaggatggtttttcatctgcttttgtagtagcccatgaaacg
ggccatgtgttgggaatggagcatgatggacaaggcaacaggtgtggtgatgagactgct
atgggaagtgtcatggctcccttggtacaagcagcattccatcgttaccactggtcccga
tgcagtggtcaagaactgaaaagatatatccattcctatgactgtctccttgatgaccct
tttgatcatgattggcctaaactcccagaacttcctggaatcaattattctatggatgag
caatgtcgttttgattttggtgttggctataaaatgtgcaccgcgttccgaacctttgac
ccatgtaaacagctgtggtgtagccatcctgataatccctacttttgtaagactaaaaag
ggacctccacttgatgggactgaatgtgctgctggaaaatggtgctataagggtcattgc
atgtggaagaatgctaatcagcaaaaacaagatggcaattgggggtcatggactaaattt
ggctcctgttctcggacatgtggaactggtgttcgtttcagaacacgccagtgcaataat
cccatgcccatcaatggtggtcaggattgtcctggtgttaattttgagtaccagctttgt
aacacagaagaatgccaaaaacactttgaggacttcagagcacagcagtgtcagcagcga
aactcccactttgaataccagaataccaaacaccactggttgccatatgaacatcctgac
cccaagaaaagatgccacctttactgtcagtccaaggagactggagatgttgcttacatg
aaacaactggtgcatgatggaacgcactgttcttacaaagatccatatagcatatgtgtg
cgaggagagtgtgtgaaagtgggctgtgataaagaaattggttctaataaggttgaggat
aagtgtggtgtctgtggaggagataattcccactgccgaaccgtgaaggggacatttacc
agaactcccaggaagcttgggtaccttaagatgtttgatataccccctggggctagacat
gtgttaatccaagaagacgaggcttctcctcatattcttgctattaagaaccaggctaca
ggccattatattttaaatggcaaaggggaggaagccaagtcgcggaccttcatagatctt
ggtgtggagtgggattataacattgaagatgacattgaaagtcttcacaccgatggacct
ttacatgatcctgttattgttttgattatacctcaagaaaatgatacccgctctagcctg
acatataagtacatcatccatgaagactctgtacctacaatcaacagcaacaatgtcatc
caggaagaattagatacttttgagtgggctttgaagagctggtctcagtgttccaaaccc
tgtggtggaggtttccagtacactaaatatggatgccgtaggaaaagtgataataaaatg
gtccatcgcagcttctgtgaggccaacaaaaagccgaaacctattagacgaatgtgcaat
attcaagagtgtacacatccactctgggtagcagaagaatgggaacactgcaccaaaacc
tgtggaagttctggctatcagcttcgcactgtacgctgccttcagccactccttgatggc
accaaccgctctgtgcacagcaaatactgcatgggtgaccgtcccgagagccgccggccc
tgtaacagagtgccctgccctgcacagtggaaaacaggaccctggagtgagtgttcagtg
acctgcggtgaaggaacggaggtgaggcaggtcctctgcagggctggggaccactgtgat
ggtgaaaagcctgagtcggtcagagcctgtcaactgcctccttgtaatgatgaaccatgt
ttgggagacaagtccatattctgtcaaatggaagtgttggcacgatactgctccatacca
ggttataacaagttatgttgtgagtcctgcagcaagcgcagtagcaccctgccaccacca
taccttctagaagctgctgaaactcatgatgatgtcatctctaaccctagtgacctccct
agatctctagtgatgcctacatctttggttccttatcattcagagacccctgcaaagaag
atgtctttgagtagcatctcttcagtgggaggtccaaatgcatatgctgctttcaggcca
aacagtaaacctgatggtgctaatttacgccagaggagtgctcagcaagcaggaagtaag
actgtgagactggtcaccgtaccatcctccccacccaccaagagggtccacctcagttca
gcttcacaaatggctgctgcttccttctttgcagccagtgattcaataggtgcttcttct
caggcaagaacctcaaagaaagatggaaagatcattgacaacagacgtccgacaagatca
tccaccttagaaagatga

DBGET integrated database retrieval system