KEGG   Homo sapiens (human): 9509Help
Entry
9509              CDS       T01001                                 

Gene name
ADAMTS2, ADAM-TS2, ADAMTS-2, ADAMTS-3, EDSDERMS, NPI, PC_I-NP, PCI-NP, PCINP, PCPNI, PNPI
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 2
  KO
K08618  a disintegrin and metalloproteinase with thrombospondin motifs 2 [EC:3.4.24.14]
Organism
hsa  Homo sapiens (human)
Disease
H02244  Ehlers-Danlos syndrome dermatospraxis type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    9509 (ADAMTS2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.14  procollagen N-endopeptidase
     9509 (ADAMTS2)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   9509 (ADAMTS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pep_M12B_propep ADAM_spacer1 TSP_1 Reprolysin ADAM_CR_2 Reprolysin_5 Reprolysin_3 Reprolysin_2 Reprolysin_4 Peptidase_M10 PLAC DUF4953
Motif
Other DBs
NCBI-GeneID: 9509
NCBI-ProteinID: NP_055059
OMIM: 604539
HGNC: 218
Ensembl: ENSG00000087116
Vega: OTTHUMG00000130915
Pharos: O95450(Tbio)
UniProt: O95450
Position
5q35.3
AA seq 1211 aa AA seqDB search
MDPPAGAARRLLCPALLLLLLLLPPPLLPPPPPPANARLAAAADPPGGPLGHGAERILAV
PVRTDAQGRLVSHVVSAATSRAGVRARRAAPVRTPSFPGGNEEEPGSHLFYNVTVFGRDL
HLRLRPNARLVAPGATMEWQGEKGTTRVEPLLGSCLYVGDVAGLAEASSVALSNCDGLAG
LIRMEEEEFFIEPLEKGLAAQEAEQGRVHVVYRRPPTSPPLGGPQALDTGASLDSLDSLS
RALGVLEEHANSSRRRARRHAADDDYNIEVLLGVDDSVVQFHGKEHVQKYLLTLMNIVNE
IYHDESLGAHINVVLVRIILLSYGKSMSLIEIGNPSQSLENVCRWAYLQQKPDTGHDEYH
DHAIFLTRQDFGPSGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDG
QGNRCGDEVRLGSIMAPLVQAAFHRFHWSRCSQQELSRYLHSYDCLLDDPFAHDWPALPQ
LPGLHYSMNEQCRFDFGLGYMMCTAFRTFDPCKQLWCSHPDNPYFCKTKKGPPLDGTMCA
PGKHCFKGHCIWLTPDILKRDGSWGAWSPFGSCSRTCGTGVKFRTRQCDNPHPANGGRTC
SGLAYDFQLCSRQDCPDSLADFREEQCRQWDLYFEHGDAQHHWLPHEHRDAKERCHLYCE
SRETGEVVSMKRMVHDGTRCSYKDAFSLCVRGDCRKVGCDGVIGSSKQEDKCGVCGGDNS
HCKVVKGTFTRSPKKHGYIKMFEIPAGARHLLIQEVDATSHHLAVKNLETGKFILNEEND
VDASSKTFIAMGVEWEYRDEDGRETLQTMGPLHGTITVLVIPVGDTRVSLTYKYMIHEDS
LNVDDNNVLEEDSVVYEWALKKWSPCSKPCGGGSQFTKYGCRRRLDHKMVHRGFCAALSK
PKAIRRACNPQECSQPVWVTGEWEPCSQTCGRTGMQVRSVRCIQPLHDNTTRSVHAKHCN
DARPESRRACSRELCPGRWRAGPWSQCSVTCGNGTQERPVLCRTADDSFGICQEERPETA
RTCRLGPCPRNISDPSKKSYVVQWLSRPDPDSPIRKISSKGHCQGDKSIFCRMEVLSRYC
SIPGYNKLCCKSCNLYNNLTNVEGRIEPPPGKHNDIDVFMPTLPVPTVAMEVRPSPSTPL
EVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQPPNLIPRRPSPYEKTRNQRIQELID
EMRKKEMLGKF
NT seq 3636 nt NT seq  +upstreamnt  +downstreamnt
atggatccgccggcgggagccgctcgccgcctgctctgccccgcgctgctgctgctgctg
ctgctgctgccgccgccgctcctgccgccgccgccgccgcccgcgaacgccaggctcgcc
gccgccgccgaccccccaggcgggcccctggggcacggagcggagcgcatcctggcggtg
cccgtgcgcactgacgcccagggccgcttggtgtcccacgtggtgtcggcagctacgtcc
agagcaggggtacgagcccgcagggccgccccggtccggaccccgagcttccccggaggc
aacgaggaggagcctggcagtcacctcttctacaatgtcacggtctttggccgagacctg
cacctgcggctgcggcccaacgcccgcctcgtggcgcccggggccactatggagtggcag
ggcgagaagggcaccacccgcgtggagcccctgctcgggagctgtctctacgtcggagac
gtggccggcctagccgaagcctcctctgtggcgctcagcaactgcgatgggctggctggt
ctgatccggatggaggaggaggagttcttcatcgaacccttggagaaggggctggcggcg
caggaggctgagcaaggccgtgtgcatgtggtgtatcgccggccacccacgtcccctcct
ctcggggggccacaggccctggacacaggggcctccctggacagcctggacagcctcagc
cgcgccctgggcgtcctagaggagcacgccaacagctcgaggcggagggcacgcaggcat
gctgcggacgatgactacaacatcgaggtcctgctgggcgtggatgactctgtggtgcag
ttccacgggaaggagcacgtacagaagtacctgctgacactcatgaacattgtcaatgaa
atctaccatgacgagtccttgggtgcccacatcaacgtggtcctggtgcggatcatcctc
ctgagctatggaaagtccatgagcctcatcgagatcgggaacccctctcagagcctggag
aatgtctgccgctgggcctacctccagcagaagccagacacgggccacgatgaataccac
gatcacgccatcttcctcacacggcaggactttgggccttccggcatgcaaggctatgct
cctgtcaccggcatgtgccatccggtccgcagctgcaccctgaaccatgaggacggcttc
tcctcagcgtttgtggtggcccatgagactggccacgtgctgggcatggagcacgacggg
cagggcaaccgctgtggcgacgaggtgcggctgggcagcatcatggcgcccctggtgcag
gccgccttccaccgcttccactggtcccgctgcagccagcaggagctgagccgctacctg
cactcctatgactgcctgctggatgaccccttcgcccacgactggccggcgctgccccag
ctcccgggactgcactactccatgaacgagcaatgccgctttgacttcggcctgggctac
atgatgtgcacggcgttccggacctttgacccctgcaagcagctgtggtgcagccatcct
gacaacccctacttttgcaagaccaagaaggggccccccttggacgggactatgtgtgca
cctggcaagcattgttttaaaggacactgcatctggctgacacctgacatcctcaaacgg
gacggcagctggggcgcttggagtccgtttggctcctgctcacgtacctgtggcacgggc
gtgaagttcaggacccgccagtgtgacaacccacacccggccaacgggggccgcacctgc
tcgggccttgcctacgacttccagctctgcagccgccaggactgccccgactccctggct
gacttccgcgaggagcagtgccgccagtgggacctgtacttcgagcacggcgacgcccag
caccactggctgccccacgagcaccgggatgccaaggagagatgccacctgtactgcgag
tccagggagaccggggaggtggtgtccatgaagcgcatggtgcatgacgggacgcgctgc
tcctacaaggacgccttcagcctctgtgtgcgcggggactgcaggaaggtgggctgtgac
ggtgtgatcggctccagcaagcaggaagacaagtgtggcgtgtgcggaggggacaacagc
cactgcaaagtggtcaagggcacgttcacacggtcacccaagaagcatggttacatcaag
atgtttgagatccctgcaggagccagacacctgctcattcaggaggtagacgccaccagc
caccatctggccgtcaagaacctggagacaggcaagttcatcttaaatgaagagaatgac
gtggatgccagttccaaaaccttcattgccatgggcgtggagtgggagtacagagacgag
gacggccgggagacgctgcagaccatgggccccctccacggcaccatcaccgttctggtc
atcccggtgggagacacccgggtctcactgacgtacaaatacatgatccatgaggactca
ctgaatgtcgacgacaacaacgtcctggaagaggactctgtggtctacgagtgggccctg
aagaagtggtctccgtgctccaagccctgtggcggagggtcccagttcaccaagtatggc
tgccgccggaggctggaccacaagatggtacaccgtggcttctgtgccgccctctcgaag
cccaaagccatccgcagagcgtgcaacccacaggaatgctcccagccagtgtgggtcaca
ggcgaatgggagccatgtagccagacctgtgggcggacaggcatgcaggtgcgctccgtg
cgctgcattcagccgctacacgacaacaccacccgctccgtgcacgccaagcactgcaat
gacgcccggcccgagagccgccgggcctgcagccgcgagctctgccctggtcgttggcga
gccgggccctggtcccagtgctcagtaacctgtggcaacggcacccaggagcggccagtg
ctctgccgcaccgcggacgacagcttcggcatctgccaggaggagcgtcctgagacagcg
aggacctgcaggcttggcccctgtccccgaaacatctcagatccctccaagaagagctac
gtagttcagtggctgtcccgcccggaccccgactcgcccatccggaagatctcgtcaaag
ggccactgccaaggcgacaagtcaatattctgtaggatggaagtcttgtcccgctattgc
tccatcccaggctacaacaagctgtgctgcaagtcctgtaacctgtacaacaacctcacc
aacgtggagggcaggatagagccaccgcctgggaagcacaacgacattgacgtgttcatg
cctaccctcccagtgcccactgtagccatggaggtgcggccatcaccaagcacccccctg
gaggtccctctcaatgcctccagcaccaatgccacagaggatcacccagaaaccaatgcc
gtagatgaaccctacaaaatccatggcctggaagatgaagtccagccacccaacctaatc
cctcgacgaccgagcccctatgaaaagaccagaaaccaaagaatccaagagctcattgat
gagatgcggaagaaagagatgctcggaaagttctaa

DBGET integrated database retrieval system